PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G116400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family Nin-like
Protein Properties Length: 365aa    MW: 41108.8 Da    PI: 6.9209
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G116400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK73.42.8e-23270319352
             RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         +++++dl +yF+lpi  AAk+L +c+T++K+iCR+y +kRWPhRk+ks+
  Aqcoe7G116400.1.p 270 GKLKISDLVHYFHLPIDVAAKKLAICPTAIKKICRKYELKRWPHRKLKSI 319
                        68999*******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.802259339IPR003035RWP-RK domain
PfamPF020421.3E-19272319IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MTKYLVLLFF DDAICANNYS RPLISGEHET DAELVDPSDR NNLLDRSFTI EEVHAPCSEI  60
VAHSNGAVFG GTIDTIQEKN GQCSRDSIGS FDDPIDDRDE QEAGADHVNS DTNAMPLAVW  120
PPEPVPYNCS CCQVLRDIVH SNGTFTTKLE IHGRVGIICH AILEVRYDAS VQHQMIDFCM  180
RRMEDVKQYL MSYCQDRKEA GFVMLQDPLV TFYSALCAGL KWDENVNTFE LIQPFQTETA  240
GFGKKGHSVA ESSSIRLPQS SLAAQRVRTG KLKISDLVHY FHLPIDVAAK KLAICPTAIK  300
KICRKYELKR WPHRKLKSIE RKISELESNS TNKNGRESRR AQAKIERLKK DRDKILSGRV  360
CEIS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021890733.14e-88uncharacterized protein LOC110809275
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-12RWP-RK domain-containing protein