PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G299200.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 258aa    MW: 29626.2 Da    PI: 9.3623
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G299200.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B330.94.7e-1013574490
                       -EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                 B3 44 rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90
                         W+v+l  rk +g   +++GWkeFv+   +++g  +vF+++++s+f
  Aqcoe6G299200.2.p 13 MAWRVEL--RKADGFACFQNGWKEFVEHYSICAGHYLVFRYNRKSQF 57
                       57*****..********************************988877 PP

2B331.92.3e-10135223191
                        EEEE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                        ffk+++++++ + +   +p+ f +++  +    +   l+ + ++g ++W v + y  ++    ++kG + F  +n+++ gD++ F+l+++++
  Aqcoe6G299200.2.p 135 FFKITMQPSYVNARYWLIPRIFSDKYlpE----GLESLSHQVPNGkNKWVVGC-YLYRGTDLRMSKGLSLFMLENNIQIGDVCYFELIKKKN 221
                        778777777777777999*****999542....334688888888799****9.666666799************************98655 PP

                        E. CS
                 B3  90 fe 91 
                          
  Aqcoe6G299200.2.p 222 VV 223
                        53 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.434165IPR003340B3 DNA binding domain
CDDcd100176.66E-7262No hitNo description
Gene3DG3DSA:2.40.330.105.4E-13365IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.2E-12572IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.7E-14129226IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-13131226IPR015300DNA-binding pseudobarrel domain
CDDcd100174.16E-9134226No hitNo description
PROSITE profilePS508638.12135232IPR003340B3 DNA binding domain
PfamPF023621.1E-8135224IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MSNDVVLKVC GCMAWRVELR KADGFACFQN GWKEFVEHYS ICAGHYLVFR YNRKSQFGVI  60
IFGLSGNEID YSRSSNNLGE FNHAKHAPLP ENEGGDGNNG DDSSGRDLMT RRLVKTEERK  120
VAIQITSPFM SKYPFFKITM QPSYVNARYW LIPRIFSDKY LPEGLESLSH QVPNGKNKWV  180
VGCYLYRGTD LRMSKGLSLF MLENNIQIGD VCYFELIKKK NVVLKVMYMT PFYVNSRYML  240
INKKDHVLKV TIASQES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A6e-1611123524143B3 domain-containing transcription factor VRN1
4i1k_B6e-1611123524143B3 domain-containing transcription factor VRN1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5DIM11e-169A0A2G5DIM1_AQUCA; Uncharacterized protein
STRINGAquca_019_00028.11e-170(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-17B3 family protein