PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G176900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family Nin-like
Protein Properties Length: 936aa    MW: 104659 Da    PI: 6.9834
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G176900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.9e-29611661252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ek+isl++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Aqcoe6G176900.1.p 611 EKTISLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIKRWPSRKIKKV 661
                        799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF557815.89E-5200305IPR029016GAF domain-like
Gene3DG3DSA:3.30.450.401.7E-4214297IPR029016GAF domain-like
PROSITE profilePS5151917.211600681IPR003035RWP-RK domain
PfamPF020427.7E-25613661IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2407.3E-22837918No hitNo description
SuperFamilySSF542772.8E-21837923No hitNo description
PROSITE profilePS5174523.045837920IPR000270PB1 domain
SMARTSM006663.8E-24837920IPR000270PB1 domain
CDDcd064076.37E-40838919No hitNo description
PfamPF005641.2E-18839919IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 936 aa     Download sequence    Send to blast
MEEGSYPQNT TLGNLSNTTM DYDLMDDLLL EGCWLEAGRS NFLQSDPSTS TALYSPSSFF  60
WPGTEIDYRF PNLNQVEENT QQVKERSIIP EDQSSIELHT ENPIEPHFIN PNANVIAKIS  120
RQSEYYLPEE FSELSRKWWI GPRDNLGSFP SVRERLFQAL RCIKKSLGKE DVLIQIWVPV  180
KSGHKQVLTT SDQPYELDPK CQRLASYRNV SMGYQFPAEE NSNESVGLPG RVFLQKVPEW  240
TPDVRYFSRD EYPRIGYAHE YDVRGTIAVP IFERGNRSCL GVLEVVMTTQ KINYNSELEH  300
VCQALEAVDL RSSDVSVRPS EKACCKSSYQ TALPEIAEVL KAVCETHRLP LAQIWVPCIQ  360
QGKGGCRHSD DNYALCISTI DSACCVTDSL HEFHEACSAH HLFIGEGVAG RAFLTNKPCL  420
STDITAFSKK QYPLKHYAKM FELRAAVAMR LRSIHDGRVD YVFEFFLPDC QDSDEQMRMC  480
DSLSIIVHQR CRNLRLITDK EVEEENIQRI CGVVIPSDGV VNAEEIPKLG PALSNDSMQA  540
SWITSMIKAQ QKGKFTEKEG VSEGFKVTSQ WIKPKELHND SKIKSTANSS IGQRSFSTVT  600
KTIEKKRTKV EKTISLQVLR QYFAGSLKDA AKSIGVCPTT LKRICRQHGI KRWPSRKIKK  660
VGHSLRKLQV VMDSVQGAEG SFKIGSLYAN FPELTSPNLS GSSVFSASKE KNLLKQLNPV  720
PEGTIRQSAD VAFSPRAAAS KSPSSSCSQS SNSSLCGSSG QHKHPLVAQF PSSEDGLRAE  780
DLGGVLKRAR SDAALQVSFQ EEPKLLERCH SLKSLAEHPG LANLPLLPEN ISGEKVALRA  840
KVTFGEEKVR FSMQTTWGIN DLRQEISKRF HIDDMSTINL KYLDDDSEWI LLTCDADVEE  900
CIEVYKSSRT QTIKFSLHQA SQPNLGSSIG SNGLS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010266179.10.0PREDICTED: protein NLP4
RefseqXP_010266180.10.0PREDICTED: protein NLP4
TrEMBLA0A2G5DTB10.0A0A2G5DTB1_AQUCA; Uncharacterized protein
STRINGAquca_015_00363.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein