PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G173100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family WOX
Protein Properties Length: 285aa    MW: 32531.8 Da    PI: 7.1153
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G173100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-17115175257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        r+R+t+t+ ql++L + F + n  p + ++++++++l     ++e++V++WFqNrRa+ k+
  Aqcoe6G173100.1.p 115 RQRWTPTPVQLQILDRIFDEgNGFPGKLKIKDITNELtqhgPISETNVSNWFQNRRARSKR 175
                        89*****************99*******************99*****************97 PP

2Wus_type_Homeobox85.65.6e-28114177265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtPtp Q++iL++++++G   P k +i++it+eL+++G i+++NV +WFQNr+aR+++kq
  Aqcoe6G173100.1.p 114 SRQRWTPTPVQLQILDRIFDEGNGFPGKLKIKDITNELTQHGPISETNVSNWFQNRRARSKRKQ 177
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-15108180IPR009057Homeodomain-like
PROSITE profilePS5007114.285111176IPR001356Homeobox domain
SMARTSM003891.1E-11113180IPR001356Homeobox domain
SuperFamilySSF466896.42E-16113177IPR009057Homeodomain-like
PfamPF000461.7E-15115175IPR001356Homeobox domain
CDDcd000861.13E-10115177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MFIPVKNLLK RKGERDQIME WKKEEEEEEK RKQTQLLQVE NTNNTSMLYM KVMTDEQMEL  60
LQKQICIYST ISQQLVEMYK SISSQHHHLS ISGMKLGNQY CDSLMMSTGN KMTSRQRWTP  120
TPVQLQILDR IFDEGNGFPG KLKIKDITNE LTQHGPISET NVSNWFQNRR ARSKRKQMVK  180
APNSAESDIE IEDESLKEKK TNSDGIPSQK TPALKSDKTC LQSFELHPAD SQSNSSNLSG  240
SKAHQISFYE SVLSSSRIDC LMGKMEDPGN FNPYSQGEGY DMIG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1168176RRARSKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270477.15e-89PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM36e-74WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLD7UDB54e-88D7UDB5_VITVI; Putative uncharacterized protein
STRINGVIT_18s0122g01140.t011e-87(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.16e-54WUSCHEL related homeobox 13