PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G101100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 348aa    MW: 39574.1 Da    PI: 10.0858
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G101100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3451.9e-14201001299
                        HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                        ++  l+lp  f++++   +  + +++le   g  W vkl  +k  ++++++kGW++F ++n ++ gD +vF+l g+s+f  +v++++k
  Aqcoe6G101100.1.p  20 TE-KLRLPLAFLKHFT--EGFPNKVILEIAPGTCWVVKL--EKVENSVFFGKGWQGFLDDNAIEIGDLLVFRLLGKSKF--YVGIYDK 100
                        33.499******6664..346778***************..*********************************99999..****997 PP

2B338.42.2e-122533321396
                        TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                 B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                         + + lp  f++++  +  esk + ++d +gr+W v++  +++ +r  + +GW    ++n+L+e  ++ F+l+++++ +l+++v
  Aqcoe6G101100.1.p 253 FKYMNLPMGFVRTYLPN--ESKSVEIMDVKGRTWLVNY--TRSLKRGSICGGWPAVRSENNLEEEYVCAFELVDKDNLKLKISV 332
                        34599*********644..66789999***********..88888877899*********************998888888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.3E-216103IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.18E-237103IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.4658101IPR003340B3 DNA binding domain
CDDcd100172.90E-15999No hitNo description
SMARTSM010199.4E-1211101IPR003340B3 DNA binding domain
PfamPF023621.3E-1219100IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.9E-19233330IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.71E-17235330IPR015300DNA-binding pseudobarrel domain
CDDcd100177.34E-14240333No hitNo description
PROSITE profilePS5086311.801241336IPR003340B3 DNA binding domain
SMARTSM010196.0E-6241336IPR003340B3 DNA binding domain
PfamPF023621.2E-10250331IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGRKPKNNPS FFKIMFGDFT EKLRLPLAFL KHFTEGFPNK VILEIAPGTC WVVKLEKVEN  60
SVFFGKGWQG FLDDNAIEIG DLLVFRLLGK SKFYVGIYDK TCCEKESIVK KTCRRREKQG  120
IVNGKCVQLK GHKGKLGKKR TSLDKMSCES SIAKNRKVRN TEKVKVLDIQ TDEFEMKTRL  180
DHQGGQKATP DESGDAVEQE ALQQQVSNGY FSLLVPWKAV SPQQIKGAYQ AAQQFKSDYP  240
FFIIQLSKCS MKFKYMNLPM GFVRTYLPNE SKSVEIMDVK GRTWLVNYTR SLKRGSICGG  300
WPAVRSENNL EEEYVCAFEL VDKDNLKLKI SVLYPKKKAV AAQVLIK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.16e-24B3 family protein