PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G100900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 146aa    MW: 17392.4 Da    PI: 10.3969
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G100900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.81.1e-1454144296
                        EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
                 B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                        f++ +p ++  +g+l++  +f++++  k  +s+ +++ d+  r+W v++  r ++++ ++ +GW    ++ +Lkeg ++ F+l++ ++ +l+
  Aqcoe6G100900.1.p  54 FTIPLPRSYVVNGMLRIKSSFVQTYLPK--KSTNISILDSFDRTWLVEY--RYRKCGSYIYNGWDTLISEYKLKEGHVCAFELIDAEDIKLK 141
                        55555666777888********999533..6789***************..55555677999**********************98988887 PP

                        EEE CS
                 B3  94 vkv 96 
                        +++
  Aqcoe6G100900.1.p 142 LSI 144
                        766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.1E-1947140IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.04E-1948135IPR015300DNA-binding pseudobarrel domain
CDDcd100174.98E-1352145No hitNo description
PfamPF023626.1E-1353144IPR003340B3 DNA binding domain
PROSITE profilePS5086311.91453145IPR003340B3 DNA binding domain
SMARTSM010191.2E-554143IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
VRDLVMQMVH RKQDAMQMDL VAQIKRRRYI HQSWKINKYL KKHVRGFRST HPFFTIPLPR  60
SYVVNGMLRI KSSFVQTYLP KKSTNISILD SFDRTWLVEY RYRKCGSYIY NGWDTLISEY  120
KLKEGHVCAF ELIDAEDIKL KLSIL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5ESD88e-23A0A2G5ESD8_AQUCA; Uncharacterized protein
STRINGAquca_005_00543.11e-23(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-09B3 family protein