PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G100600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 536aa    MW: 60271.6 Da    PI: 10.014
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G100600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.34.9e-17997198
                       EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                 B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                       ffkv ++ + ++   l +p  ++++++g+   +k+ +l++++ r+W v    + ++++++l + W++Fvk+n L+ gDf+vF+++g+sef   v
  Aqcoe6G100600.1.p  9 FFKVIIHDSFNE---LHIPTAYIRHFNGD--VPKKFILRSPTKRVWMVSA--KENDNGVFLYDEWRSFVKDNALEFGDFLVFRYNGKSEF--SV 93
                       677774444443...67******998777..3568***************..********************************998988..88 PP

                       EEE- CS
                 B3 95 kvfr 98
                       ++f 
  Aqcoe6G100600.1.p 94 TIFG 97
                       8875 PP

2B359.46.3e-1918827412100
                        HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-SS CS
                 B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrks 100
                        k+ r+v+p+  a+e+g+k++    ++l d+ grsW v++i+r+  ++++lt+GW +F  an+++ gD++ F++++  +  l+v +frks
  Aqcoe6G100600.1.p 188 KKYRIVIPRGLARENGLKQK--DNVVLLDPCGRSWPVTIIHRRDIETTTLTSGWANFRVANDINIGDTCRFEFIEGLGDALRVYIFRKS 274
                        56689**********99954..47**************************************************996666******985 PP

3B351.22.3e-164505311195
                        HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-.SS.SEE..EEE CS
                 B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld.gr.sefelvvk 95 
                        +ks+ lvlp +fa+++++    ++ +tl+  +g +W   +   k + ++ l +GW+ Fv +n+Lke D++ F+l+ g+ +  el+v+
  Aqcoe6G100600.1.p 450 SKSHTLVLPSPFAKKYMKR--APRNVTLRVINGGTWHALY---KIGAHHKLVRGWNAFVLDNHLKEDDVCNFELVdGNrNHYELKVS 531
                        45699***********866..55679999999********...55567899**********************88455555555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.73E-244105IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.7E-234101IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.465699IPR003340B3 DNA binding domain
CDDcd100173.88E-17796No hitNo description
PfamPF023629.5E-15996IPR003340B3 DNA binding domain
SMARTSM010191.5E-13999IPR003340B3 DNA binding domain
PROSITE profilePS5086313.578177274IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.0E-19177274IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.46E-19179274IPR015300DNA-binding pseudobarrel domain
CDDcd100179.05E-17179272No hitNo description
SMARTSM010192.2E-17180274IPR003340B3 DNA binding domain
PfamPF023621.8E-16188273IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.9E-19431533IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-19434524IPR015300DNA-binding pseudobarrel domain
CDDcd100177.93E-18437534No hitNo description
SMARTSM010191.6E-11439534IPR003340B3 DNA binding domain
PROSITE profilePS5086312.802440535IPR003340B3 DNA binding domain
PfamPF023621.4E-13450531IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MGRSNSPSFF KVIIHDSFNE LHIPTAYIRH FNGDVPKKFI LRSPTKRVWM VSAKENDNGV  60
FLYDEWRSFV KDNALEFGDF LVFRYNGKSE FSVTIFGSDA CEKEVPLALK NDVESISHLK  120
DTSKVKKMDS PEKVHSGILQ TCPEEKRDNE AVVMDKMTSL PDSKPLSAER IKKLEATNSF  180
TVTFKPAKKY RIVIPRGLAR ENGLKQKDNV VLLDPCGRSW PVTIIHRRDI ETTTLTSGWA  240
NFRVANDINI GDTCRFEFIE GLGDALRVYI FRKSIKAPSG KQATAGMAIS TYTPKEEIEA  300
PKRKGPRELV NDRATKYIRQ ERCTRFGLQL NKMDEGDHLD SDCSNNHSTL PNVTSPIGDN  360
PHQRKNPEDP QELPSSILYS GVQSNVSKTR TSKSAAISGR VKKAPGRKPL ESMPSRDAAA  420
QEKERNIATA ASTSNKPFCS VTMRATYVGS KSHTLVLPSP FAKKYMKRAP RNVTLRVING  480
GTWHALYKIG AHHKLVRGWN AFVLDNHLKE DDVCNFELVD GNRNHYELKV SIDRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5E5610.0A0A2G5E561_AQUCA; Uncharacterized protein
STRINGAquca_011_00002.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.14e-27B3 family protein