PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G100300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 526aa    MW: 59678.5 Da    PI: 9.4902
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G100300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.52.1e-12997198
                       EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                 B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                       ffk l   + +++  ++lp +++++++g+   +k+ +l++++ r Wev +  +k ++  +l++ W  F+k+n L+ gD +vF ++g+ ef  +v
  Aqcoe6G100300.1.p  9 FFKLL--IHDFSQE-MCLPTDYIKNFNGDV--PKQFILTSSTRRFWEVFV--KKIDNNLFLSEQWPIFAKDNALEFGDLLVFIYNGNLEF--RV 93
                       67777..6677776.9*******8886664..4469**************..********************************987666..99 PP

                       EEE- CS
                 B3 95 kvfr 98
                       k+f 
  Aqcoe6G100300.1.p 94 KIFG 97
                       9986 PP

2B355.41.1e-171912721599
                        -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                         + +p++ ++e g++ +   ++ l d+ grsW v++ y+ ++gr++lt+GW  F+kan+L+++D++ F++++  +   +v +fr+
  Aqcoe6G100300.1.p 191 KIGIPNEIVKEKGLSVKD--KMLLLDPCGRSWPVTI-YCWSKGRTFLTAGWPAFCKANRLNTNDTCHFQFIDGVDNAIRVEIFRT 272
                        4679*****999888544..8***************.766777899***********************9988777799999996 PP

3B360.13.9e-19433524498
                        E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-.SS.SEE..E CS
                 B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld.gr.sefelv 93 
                        ++ p +v+ks  lvlp  fa++h++  ++   ++l+d++g +W  ++  + + +++ l  GWk Fv +n+Lke D+++F+l+ ++ +  el+
  Aqcoe6G100300.1.p 433 AMHPTYVGKSFALVLPSAFAKKHMKHAPR--GVILRDSNGGTWHAQY--KIG-SHHKLNMGWKTFVFDNHLKECDVCIFELVdENlTHYELK 519
                        67799******************866555..5***************..555.5889***********************885668888888 PP

                        EEEE- CS
                 B3  94 vkvfr 98 
                        v+++r
  Aqcoe6G100300.1.p 520 VTIIR 524
                        88887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.0E-164101IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.24E-204101IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.956699IPR003340B3 DNA binding domain
CDDcd100175.92E-14796No hitNo description
SMARTSM010198.2E-11999IPR003340B3 DNA binding domain
PfamPF023625.8E-10997IPR003340B3 DNA binding domain
PROSITE profilePS5086312.703177273IPR003340B3 DNA binding domain
SuperFamilySSF1019362.55E-18179271IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.7E-17179271IPR015300DNA-binding pseudobarrel domain
CDDcd100176.71E-14179271No hitNo description
SMARTSM010191.1E-8180273IPR003340B3 DNA binding domain
PfamPF023626.8E-15191272IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-22422524IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.45E-21425515IPR015300DNA-binding pseudobarrel domain
CDDcd100176.01E-19428524No hitNo description
PROSITE profilePS5086312.858430525IPR003340B3 DNA binding domain
SMARTSM010192.0E-9430524IPR003340B3 DNA binding domain
PfamPF023622.5E-16432524IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MGRSNVPSFF KLLIHDFSQE MCLPTDYIKN FNGDVPKQFI LTSSTRRFWE VFVKKIDNNL  60
FLSEQWPIFA KDNALEFGDL LVFIYNGNLE FRVKIFGSNA CEKDVELALK NNVESDFYLR  120
EEKEGNDRGI PDKLHSPDIL KCYKRRRTAE AAVTDKVTSL PNSMSIKTER SEVMEVGLSF  180
NATFQPSRKY KIGIPNEIVK EKGLSVKDKM LLLDPCGRSW PVTIYCWSKG RTFLTAGWPA  240
FCKANRLNTN DTCHFQFIDG VDNAIRVEIF RTRTPPPIAK QASAGVKMST AIPREVIEAP  300
TRKRPGEFVD DRVIHNGKQE SLLMTDCSNN DEQTMSTAPN VAVTIPIDDK LHQLKNAGDP  360
LELPSSILYS GVQSNANKTK KSKSVDNFPD RMKQKSRKKQ LDSRTNRLIA TQEKDRIIAA  420
AAFTSKNPFC CVAMHPTYVG KSFALVLPSA FAKKHMKHAP RGVILRDSNG GTWHAQYKIG  480
SHHKLNMGWK TFVFDNHLKE CDVCIFELVD ENLTHYELKV TIIRH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139145LKCYKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5E9G30.0A0A2G5E9G3_AQUCA; Uncharacterized protein
STRINGAquca_010_00338.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.11e-28B3 family protein