PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G028600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 271aa    MW: 31028.8 Da    PI: 8.5654
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G028600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.79.7e-14381141799
                        E--HHH.HTT.---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  17 vlpkkfaeeh.ggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                        ++pk f+++h +g+  e+++ +l+++++ + W +    +++     +t+GW++F+++++L++gD ++F+++   +f+++v vf++
  Aqcoe6G028600.1.p  38 SIPKAFMKDHlEGERCEGRKTMLRTTKScKPWVIHT--KGC----CFTDGWEDFAREHDLRVGDLLLFRHE--GGFNFNVIVFDA 114
                        7**********6566667788888866648887777..444....59**********************65..589889999986 PP

2B339.21.2e-12174239876
                        -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--T CS
                 B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLke 76 
                        + ++  + l +p +f +++g++k++  +++l+d++g+ Wev l++++  ++ ++++GW+ F  an++ke
  Aqcoe6G028600.1.p 174 HAHFDWKDLLVPANFRRKYGLNKPC--MIMLKDPEGEYWEVGLRHKRD-CQAYIGRGWSTFLYANRMKE 239
                        44444456899***********877..8***************75555.56679************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.8E-185117IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-158121IPR015300DNA-binding pseudobarrel domain
CDDcd100172.21E-1111113No hitNo description
SMARTSM010193.0E-731115IPR003340B3 DNA binding domain
PfamPF023622.7E-1038114IPR003340B3 DNA binding domain
PROSITE profilePS5086310.75739115IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.9E-13162239IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.08E-13166239IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.474167263IPR003340B3 DNA binding domain
CDDcd100176.29E-7167246No hitNo description
SMARTSM010194.1E-4168258IPR003340B3 DNA binding domain
PfamPF023622.5E-10170239IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MAKTTSRPRN PHFFKFIMPA AFEGILALKC FDIVLIHSIP KAFMKDHLEG ERCEGRKTML  60
RTTKSCKPWV IHTKGCCFTD GWEDFAREHD LRVGDLLLFR HEGGFNFNVI VFDATMCERV  120
YQPLDGDTID DDDHILMEKK KEQNDGIAKG YPSSKGTAGM VKPVKNSFSV TMRHAHFDWK  180
DLLVPANFRR KYGLNKPCMI MLKDPEGEYW EVGLRHKRDC QAYIGRGWST FLYANRMKEQ  240
LGFTQIVNAN ATIMSDANVF NDKITLTSIS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5DVJ81e-130A0A2G5DVJ8_AQUCA; Uncharacterized protein
STRINGAquca_014_00276.11e-131(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31690.16e-28B3 family protein