PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G181200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family SRS
Protein Properties Length: 348aa    MW: 37970.9 Da    PI: 8.2192
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G181200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702224.52e-69902494154
             DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.....aeaaskrkrel.....kskkqsa 85 
                         ++sCqdCGnqakkdC+h+RCRtCCksrgfdC+thvkstWvpa++rrer qq++ + + aa+++       +++kr+re+     ++++++a
  Aqcoe5G181200.1.p  90 RSVSCQDCGNQAKKDCVHTRCRTCCKSRGFDCHTHVKSTWVPASRRRERLQQQQLQLQPAAQQQqqrrgMMENTKRPRENllactTNTTTTA 181
                        5789*********************************************6666655444444444566778889999998665433444444 PP

             DUF702  86 lsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                        +++++l+s++s  e+  +s+P+evss+avfrcvrvs++dd++e++aYqtav+igGhvfkGiLydqG+++
  Aqcoe5G181200.1.p 182 TTTSRLPSHTSGLEV-GQSFPAEVSSPAVFRCVRVSAMDDADEQYAYQTAVNIGGHVFKGILYDQGPDR 249
                        555555666655444.455************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.8E-6791248IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016236.3E-2793135IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.4E-28200247IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MAGFSLGSGS GGGNQQNQIP QENLYLYKNE EILAYNKELQ LWQQQQQHLQ RQYQQQQGIY  60
GSTSNNTTTM NMMMRSSSSS QGGGSGSGER SVSCQDCGNQ AKKDCVHTRC RTCCKSRGFD  120
CHTHVKSTWV PASRRRERLQ QQQLQLQPAA QQQQQRRGMM ENTKRPRENL LACTTNTTTT  180
ATTTSRLPSH TSGLEVGQSF PAEVSSPAVF RCVRVSAMDD ADEQYAYQTA VNIGGHVFKG  240
ILYDQGPDRD NHPHQHHHYG GGESSSGGGG GGGGAVRDHQ GNLITSSTAA ATPNLFVDPS  300
SAMYPTPLNA FLAGKLTKIY SHTSKMKECI DCVLEQTTNE PSLHPYS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010271515.12e-88PREDICTED: protein SHI RELATED SEQUENCE 1-like
TrEMBLA0A061DFV63e-81A0A061DFV6_THECC; Lateral root primordium protein-related, putative
STRINGGSMUA_Achr5P14410_0016e-74(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.12e-54Lateral root primordium (LRP) protein-related