PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G171300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 293aa    MW: 33174 Da    PI: 9.7693
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G171300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B362.28.5e-20897199
                       EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                 B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                       ffk+l     ++++ l +pk f++++++k  +sk+ +l+ +sg  W vkl  ++k  +++l++GW +F +a+ L +g f+vF +dg+++f  +v
  Aqcoe5G171300.1.p  8 FFKIL--VEDFEQK-LQIPKAFMKNISEK--SSKMAILKGPSGSCWHVKL--TRKTTGMYLEDGWGSFSRAHSLSVGKFLVFGYDGNMTF--TV 92
                       66777..4555555.99******888755..889****************..999999****************************9999..** PP

                       EEE-S CS
                 B3 95 kvfrk 99
                       ++f++
  Aqcoe5G171300.1.p 93 QIFDS 97
                       **997 PP

2B332.71.3e-102122901798
                        E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                 B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                         +p++f +++ ++ ++   +tl+ ++grs +v + ++ + + + +++GWk+  +  ++k+g  +vF+l+++++  ++v+++r
  Aqcoe5G171300.1.p 212 PIPRSFSRRYFSEGAG--NITLMLSDGRSLNVGY-INYYTNICKMSRGWKHLLEVFDIKVGNLCVFELIRSDNLLFKVHILR 290
                        59********655445..57777888********.477777799*************************9888878888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.7E-24298IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-23298IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.226598IPR003340B3 DNA binding domain
CDDcd100172.01E-20796No hitNo description
PfamPF023627.9E-17897IPR003340B3 DNA binding domain
SMARTSM010199.7E-19898IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-16193290IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.0E-14193290IPR015300DNA-binding pseudobarrel domain
CDDcd100172.50E-10197290No hitNo description
SMARTSM010190.0022198292IPR003340B3 DNA binding domain
PfamPF023627.4E-9208290IPR003340B3 DNA binding domain
PROSITE profilePS508639.277213292IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MESRKSHFFK ILVEDFEQKL QIPKAFMKNI SEKSSKMAIL KGPSGSCWHV KLTRKTTGMY  60
LEDGWGSFSR AHSLSVGKFL VFGYDGNMTF TVQIFDSSTL EEESAFAVIN TQEKIKCEGI  120
KRHGRPSKAQ SNHANSCHTS VEPCSLTPNA EHHQGKSVLE QRKPHQSYRS ISDKGKNYSM  180
EKDRAVHAAK ICKPDHPFFT IGMQPSYALY GPIPRSFSRR YFSEGAGNIT LMLSDGRSLN  240
VGYINYYTNI CKMSRGWKHL LEVFDIKVGN LCVFELIRSD NLLFKVHILR DA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5EK500.0A0A2G5EK50_AQUCA; Uncharacterized protein
STRINGAquca_007_00470.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-26B3 family protein