PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe4G200300.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 445aa    MW: 50076.2 Da    PI: 9.746
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe4G200300.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.33.7e-105485398
                       EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                 B3 53 rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                       + ++++++l + W++Fvk+n L+ gDf+vF+++g+sef   v++f 
  Aqcoe4G200300.4.p  5 KENDNGVFLCDEWRSFVKDNTLEFGDFLVFTYNGKSEF--SVTIFG 48
                       6788899999**********************998988..888875 PP

2B360.23.6e-191412251299
                        HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                        k+ r+++p++ a+e+g+k++    ++l d+ grsW v++++++ + +++lt+GW +F  an+++ gD+++F++++  +  l+v +fr+
  Aqcoe4G200300.4.p 141 KKYRIIIPRDLARENGLKQK--DNVVLLDPCGRSWPVTIKHQRDR-ETTLTSGWANFRVANKINIGDTCLFEFIEGLGDALRVYIFRT 225
                        55689**********99954..47***************554444.489*************************9966669****997 PP

3B354.62e-173594401195
                        HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-.SS.SEE..EEE CS
                 B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld.gr.sefelvvk 95 
                        +ks++lvlp +fa+++++    ++ +tl+d +g +W   +i+   + ++ l +GW+ Fv +n+Lke D++ F+l+ g+ +  el+v+
  Aqcoe4G200300.4.p 359 SKSHNLVLPSRFAKKYMKR--APRNVTLRDIDGGTWHALYII---GAHHKLVRGWNAFVLDNHLKEDDVCNFELVdGNrNHYELKVS 440
                        45699***********866..5668***************44...3346799*********************88455555555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100171.45E-8147No hitNo description
PROSITE profilePS5086311.533150IPR003340B3 DNA binding domain
PfamPF023621.2E-7547IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.8E-12660IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.51E-13655IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.0E-20130226IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.649130226IPR003340B3 DNA binding domain
SuperFamilySSF1019362.16E-19132226IPR015300DNA-binding pseudobarrel domain
CDDcd100171.95E-16132224No hitNo description
SMARTSM010191.7E-18133226IPR003340B3 DNA binding domain
PfamPF023621.3E-16141225IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-19340442IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-20343433IPR015300DNA-binding pseudobarrel domain
CDDcd100178.61E-19346443No hitNo description
SMARTSM010196.5E-13348443IPR003340B3 DNA binding domain
PROSITE profilePS5086313.197349444IPR003340B3 DNA binding domain
PfamPF023627.1E-15359440IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MVSAKENDNG VFLCDEWRSF VKDNTLEFGD FLVFTYNGKS EFSVTIFGSD ACEKVVPLTL  60
KKDVESISHL KDTTTSQVKE MDSPEKLHSG ILQICPEKKR DDEAVVMDKM TSLPDSKPLN  120
AERIEKLEAT NSFTVTFSPA KKYRIIIPRD LARENGLKQK DNVVLLDPCG RSWPVTIKHQ  180
RDRETTLTSG WANFRVANKI NIGDTCLFEF IEGLGDALRV YIFRTSRKAP SGKQATAGMP  240
ISTYTPKGEI EALKRKGPRE LINDRAAKYI KEERNPEEPQ ELPSSILYSV VQSNVSKTRM  300
SKSAAISGRI KKAPTRKPLE SMSSRHAAAQ EKERNIAMTA STSNKPFCSV TLRSTYVGSK  360
SHNLVLPSRF AKKYMKRAPR NVTLRDIDGG TWHALYIIGA HHKLVRGWNA FVLDNHLKED  420
DVCNFELVDG NRNHYELKVS IDRS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5E5740.0A0A2G5E574_AQUCA; Uncharacterized protein
STRINGAquca_011_00002.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.17e-21B3 family protein