PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe4G200300.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 373aa    MW: 42096.2 Da    PI: 10.3236
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe4G200300.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B360.72.5e-19681531199
                        HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                         k+ r+++p++ a+e+g+k++    ++l d+ grsW v++++++ + +++lt+GW +F  an+++ gD+++F++++  +  l+v +fr+
  Aqcoe4G200300.3.p  68 AKKYRIIIPRDLARENGLKQK--DNVVLLDPCGRSWPVTIKHQRDR-ETTLTSGWANFRVANKINIGDTCLFEFIEGLGDALRVYIFRT 153
                        455689**********99954..47***************554444.489*************************9966669****997 PP

2B3551.5e-172873681195
                        HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-.SS.SEE..EEE CS
                 B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld.gr.sefelvvk 95 
                        +ks++lvlp +fa+++++    ++ +tl+d +g +W   +i+   + ++ l +GW+ Fv +n+Lke D++ F+l+ g+ +  el+v+
  Aqcoe4G200300.3.p 287 SKSHNLVLPSRFAKKYMKR--APRNVTLRDIDGGTWHALYII---GAHHKLVRGWNAFVLDNHLKEDDVCNFELVdGNrNHYELKVS 368
                        45699***********866..5668***************44...3346799*********************88455555555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086314.64958154IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.5E-2058154IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.55E-1960154IPR015300DNA-binding pseudobarrel domain
CDDcd100176.45E-1760152No hitNo description
SMARTSM010191.7E-1861154IPR003340B3 DNA binding domain
PfamPF023629.9E-1769153IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.1E-20268370IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.75E-20271361IPR015300DNA-binding pseudobarrel domain
CDDcd100172.21E-19274371No hitNo description
SMARTSM010196.5E-13276371IPR003340B3 DNA binding domain
PROSITE profilePS5086313.197277372IPR003340B3 DNA binding domain
PfamPF023625.3E-15287368IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MGRSNSPSFF KFLIHDSFNE LICPEKKRDD EAVVMDKMTS LPDSKPLNAE RIEKLEATNS  60
FTVTFSPAKK YRIIIPRDLA RENGLKQKDN VVLLDPCGRS WPVTIKHQRD RETTLTSGWA  120
NFRVANKINI GDTCLFEFIE GLGDALRVYI FRTSRKAPSG KQATAGMPIS TYTPKGEIEA  180
LKRKGPRELI NDRAAKYIKE ERNPEEPQEL PSSILYSVVQ SNVSKTRMSK SAAISGRIKK  240
APTRKPLESM SSRHAAAQEK ERNIAMTAST SNKPFCSVTL RSTYVGSKSH NLVLPSRFAK  300
KYMKRAPRNV TLRDIDGGTW HALYIIGAHH KLVRGWNAFV LDNHLKEDDV CNFELVDGNR  360
NHYELKVSID RS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5E5740.0A0A2G5E574_AQUCA; Uncharacterized protein
STRINGAquca_011_00002.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-11B3 family protein