PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe4G200300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 392aa    MW: 44490.2 Da    PI: 10.1856
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe4G200300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.44.6e-17997198
                       EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                 B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                       ffk l++   + +  l++p  ++++++g+   +k+ +l++++ r+W v    + ++++++l + W++Fvk+n L+ gDf+vF+++g+sef   v
  Aqcoe4G200300.2.p  9 FFKFLIH--DSFN-ELRIPTAYIRHFNGD--VPKKFILRSPTKRTWMVSA--KENDNGVFLCDEWRSFVKDNTLEFGDFLVFTYNGKSEF--SV 93
                       6677733..3333.389******998777..3568***************..********************************998988..88 PP

                       EEE- CS
                 B3 95 kvfr 98
                       ++f 
  Aqcoe4G200300.2.p 94 TIFG 97
                       8875 PP

2B360.52.9e-191902741299
                        HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                        k+ r+++p++ a+e+g+k++    ++l d+ grsW v++++++ + +++lt+GW +F  an+++ gD+++F++++  +  l+v +fr+
  Aqcoe4G200300.2.p 190 KKYRIIIPRDLARENGLKQK--DNVVLLDPCGRSWPVTIKHQRDR-ETTLTSGWANFRVANKINIGDTCLFEFIEGLGDALRVYIFRT 274
                        55689**********99954..47***************554444.489*************************9966669****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.3E-234101IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.24E-244104IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.394699IPR003340B3 DNA binding domain
CDDcd100174.41E-17796No hitNo description
SMARTSM010191.9E-13999IPR003340B3 DNA binding domain
PfamPF023621.4E-14996IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.0E-20179275IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.649179275IPR003340B3 DNA binding domain
SuperFamilySSF1019361.69E-19181275IPR015300DNA-binding pseudobarrel domain
CDDcd100175.13E-16181273No hitNo description
SMARTSM010191.7E-18182275IPR003340B3 DNA binding domain
PfamPF023621.1E-16190274IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGRSNSPSFF KFLIHDSFNE LRIPTAYIRH FNGDVPKKFI LRSPTKRTWM VSAKENDNGV  60
FLCDEWRSFV KDNTLEFGDF LVFTYNGKSE FSVTIFGSDA CEKVVPLTLK KDVESISHLK  120
DTTTSQVKEM DSPEKLHSGI LQICPEKKRD DEAVVMDKMT SLPDSKPLNA ERIEKLEATN  180
SFTVTFSPAK KYRIIIPRDL ARENGLKQKD NVVLLDPCGR SWPVTIKHQR DRETTLTSGW  240
ANFRVANKIN IGDTCLFEFI EGLGDALRVY IFRTSRKAPS GKQATAGMPI STYTPKGEIE  300
ALKRKGPREL INDRAAKYIK EERNPEEPQE LPSSILYSVV QSNVSKTRMS KSAAISGRIK  360
KAPTRKPLGK YNTKININHL MFCRPLLKNM R*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5E5610.0A0A2G5E561_AQUCA; Uncharacterized protein
STRINGAquca_011_00002.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.16e-28B3 family protein