PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G174700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family CO-like
Protein Properties Length: 489aa    MW: 54586.7 Da    PI: 6.1984
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G174700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.64.6e-07537436
           zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                         C+ +++++++lfC+ ++  lC  C l+ H+ 
  Aqcoe3G174700.1.p  5 IPCDYCGDEKAILFCRADSAKLCLLCDLHVHSA 37
                       57******99*******************9965 PP

2zf-B_box24.27.1e-084792342
           zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                        ++C++++++++++ C +++  lC++C    H +      H++ p+
  Aqcoe3G174700.1.p 47 SQICDNCNSEPVSIRCSTDNLVLCQECDWDAHGNcsvsasHERNPI 92
                       579*************************999966888889988775 PP

3CCT65.21.9e-22436480145
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                        R +a+lRYkeK++tR+F+K+irYesRKa+A++R+RvKGrFvk++e
  Aqcoe3G174700.1.p 436 RGNAMLRYKEKKRTRRFDKHIRYESRKARADTRKRVKGRFVKASE 480
                        7789**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.9E-12249IPR000315B-box-type zinc finger
PROSITE profilePS501199.783249IPR000315B-box-type zinc finger
CDDcd000214.14E-8537No hitNo description
PfamPF006437.2E-6644IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3244592IPR000315B-box-type zinc finger
PfamPF006432.9E-54892IPR000315B-box-type zinc finger
CDDcd000212.32E-64992No hitNo description
SMARTSM003360.395092IPR000315B-box-type zinc finger
PfamPF062032.8E-16436478IPR010402CCT domain
PROSITE profilePS5101715.1436478IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MGERIPCDYC GDEKAILFCR ADSAKLCLLC DLHVHSANDL SKKHLRSQIC DNCNSEPVSI  60
RCSTDNLVLC QECDWDAHGN CSVSASHERN PIEGISGCPS AIELASIWGF DLVEKNTTNN  120
NNSSSVSSLP SIQEDSNSVF SNWSSLDSIL YIDSWIGSNS IENNNLQELI AKEEEENSNS  180
NLNRNSASFL YPNVPCAQIP QASSKKGQNP SCGKHKQLIL KQLLQLFKRD LNRDAEDLSP  240
GTPTQQGSAE GIDLQKGVCV GDLMDANQMM QQQLPYTSLL MSSVETDHKG NVRLLEDHHL  300
WGCNPPSSES SQIWDFNLGR SRDHEAPNQL EDGYSTNSEG FMIQTYTDFT KKTPSETTKV  360
LEDVYGINCS TTGHHMKSDY NTSKKPASSR RTLTSESNNL NLPGADINYM EQPLLLRGEN  420
ARTTTKVDME LLAQNRGNAM LRYKEKKRTR RFDKHIRYES RKARADTRKR VKGRFVKASE  480
TPDVDASR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010249152.11e-171PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
TrEMBLA0A067JHF91e-149A0A067JHF9_JATCU; Uncharacterized protein
STRINGVIT_01s0146g00360.t011e-146(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.16e-88B-box type zinc finger protein with CCT domain