PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G131200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 619aa    MW: 68909 Da    PI: 7.1861
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G131200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.16.6e-1826115196
                        EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                        ffkvl+ ++    + l++p kf  ++  ++   ++++ led++g++W+v++  ++ ++r v+++GW +F++++ L++gDf+vF++   s f 
  Aqcoe3G131200.1.p  26 FFKVLVDEHEKFMKFLTIPPKFSPAIvPLV---DQKIDLEDSKGQRWSVQV--SRLGERLVFQNGWDQFASDHFLETGDFLVFSYFIGSHF- 111
                        99********************98886444...458***************..*******************************8644666. PP

                        .EEEE CS
                 B3  92 lvvkv 96 
                          v++
  Aqcoe3G131200.1.p 112 -IVQI 115
                        .5555 PP

2B333.38.6e-115536143295
                        --SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                 B3  32 esktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                          k + ++d+s r W v +   ++sg  vl++GW   +kan+++egD ++F  d+ se+++ ++
  Aqcoe3G131200.1.p 553 DRKIILIRDPSRRLWPVLY--LQSSGFKVLGAGWALVAKANNIREGDQCIFAIDNGSEGTFGLS 614
                        456788999**********..*******************************887688866555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-2023121IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-2123121IPR015300DNA-binding pseudobarrel domain
CDDcd100178.39E-2124117No hitNo description
PROSITE profilePS5086314.59326119IPR003340B3 DNA binding domain
PfamPF023624.7E-1626116IPR003340B3 DNA binding domain
SMARTSM010191.5E-926119IPR003340B3 DNA binding domain
PROSITE profilePS5086310.419520618IPR003340B3 DNA binding domain
SMARTSM010190.44523617IPR003340B3 DNA binding domain
CDDcd100171.24E-7547617No hitNo description
PfamPF023623.9E-8548615IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-10549608IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.5E-9554613IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    Send to blast
MEACQECAKR CLNKNPSSVL PVVPSFFKVL VDEHEKFMKF LTIPPKFSPA IVPLVDQKID  60
LEDSKGQRWS VQVSRLGERL VFQNGWDQFA SDHFLETGDF LVFSYFIGSH FIVQIYCRSG  120
CPKLNFPEKF SGSRESSDVD MSVDPPTSDD KTLTPEEVSP QMNDKSSKNE QGSCSSVHSD  180
WNVDRSRIPC NVPIAEKIPT STAMRTPCNN NTAKSKPVLD DGCTEVPFYM IDRTFIDVEN  240
VGTCLFDLSE FELVKGRSAV NVEKPVVMEN GRSPNCVAES VPPQTRQGTD CFEDYCNIFN  300
TRPGDTERKC RGDPLDVADL GVSERRYHSQ YIDKVPLFKE NSSATGCISR QPERECESGK  360
KASLFKDKNS MNVTSPRQPQ TRLKADCAGN GMGNTDFSGA FCKPLPEKRK SVFSEMDAVS  420
QLNQNIFAGS CGSVTNTKKM VSGFGNDFSM GRNDYLTGKK MKVGKEEHLE KNDEKLGKRP  480
AVVKCELQEE VYPSLKFQGQ ASNMVKTENI DSGWSSPFSS NDYCSSVTAV TRSFLEFPTD  540
RPPIVGFGRK RMDRKIILIR DPSRRLWPVL YLQSSGFKVL GAGWALVAKA NNIREGDQCI  600
FAIDNGSEGT FGLSIARK*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5CGM90.0A0A2G5CGM9_AQUCA; Uncharacterized protein
STRINGAquca_056_00103.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18960.16e-13B3 family protein