PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G107800.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 249aa    MW: 28036.4 Da    PI: 9.6948
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G107800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.44.1e-1612901193
                       HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
                 B3 11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93
                       +k ++l lp +f+eehg++   s  l+l+ ++g +W++ l  rk  gr+v+ +GWkeF++   L++g  + F+++g+s+f  v
  Aqcoe2G107800.2.p 12 GKDCQLELPSEFVEEHGNQ--LSDGLVLKVRTGDTWNIGL--RKFAGRIVFNGGWKEFAHHYSLDAGYCLFFTYSGNSRFDVV 90
                       789*************977..6678***************..**********************************9999544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.689295IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-19494IPR015300DNA-binding pseudobarrel domain
SMARTSM010197.4E-10695IPR003340B3 DNA binding domain
PfamPF023621.9E-121290IPR003340B3 DNA binding domain
CDDcd100174.51E-151291No hitNo description
SuperFamilySSF1019365.1E-181394IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MKRNKFFRII GGKDCQLELP SEFVEEHGNQ LSDGLVLKVR TGDTWNIGLR KFAGRIVFNG  60
GWKEFAHHYS LDAGYCLFFT YSGNSRFDVV IMDPGDAEII YPSKVVKFKE PKTMVPMAKN  120
NGTEKKFVKK LSITCNKDNL RESVLFAGKQ HQGKQIFELG EPSFCRMVED VATNEVHAAK  180
PSFLQTKEKN GGVSTVMAFM SNHPFFKLNV SSAYHKHRHM IIVVTFSSVN AGLNLVLTHL  240
GHQYCLHT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5ETT00.0A0A2G5ETT0_AQUCA; Uncharacterized protein
STRINGAquca_004_00155.11e-164(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-19B3 family protein