PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G100800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family WOX
Protein Properties Length: 172aa    MW: 19619.1 Da    PI: 7.2901
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G100800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.51.5e-202586157
                       TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                       ++ R+++t+eq+++L +lF++  r+ps+++++ ++++l    +++ ++V++WFqN++a+e++
  Aqcoe2G100800.1.p 25 KCGRWNPTAEQVKVLTDLFRSgLRTPSTDQIQNISSQLsfygKIESKNVFYWFQNHKARERQ 86
                       568*****************99**************************************97 PP

2Wus_type_Homeobox113.69.9e-372588265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++ RW+Pt+eQ+k+L++l++sGlrtP++++iq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+
  Aqcoe2G100800.1.p 25 KCGRWNPTAEQVKVLTDLFRSGLRTPSTDQIQNISSQLSFYGKIESKNVFYWFQNHKARERQKR 88
                       678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.8512287IPR001356Homeobox domain
SMARTSM003894.5E-42491IPR001356Homeobox domain
PfamPF000461.1E-172686IPR001356Homeobox domain
SuperFamilySSF466891.07E-112789IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-82886IPR009057Homeodomain-like
CDDcd000866.16E-52888No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MEEGMSGFCI KVSGGRNGGN EGGTKCGRWN PTAEQVKVLT DLFRSGLRTP STDQIQNISS  60
QLSFYGKIES KNVFYWFQNH KARERQKRRR ISVDDHRPSV IDPEEKSLLP KYFAEMNQVT  120
EPERVIETLQ LFPLNSYNDS EPDKLIFFRN DCKENIAYSG YPPLDLCLSS L*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18690KRRRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009344529.15e-77PREDICTED: WUSCHEL-related homeobox 7
SwissprotQ8H1D21e-54WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLA0A0B2PZT73e-71A0A0B2PZT7_GLYSO; WUSCHEL-related homeobox 5
TrEMBLI1JI623e-71I1JI62_SOYBN; Uncharacterized protein
TrEMBLM5XSQ73e-71M5XSQ7_PRUPE; Uncharacterized protein
STRINGGLYMA02G42200.18e-71(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.14e-53WUSCHEL related homeobox 5