PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G451800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 262aa    MW: 30300 Da    PI: 10.2198
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G451800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3543.1e-1725115198
                        EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                        ffk+  +++  k ++l lp+kf+++h+++   +   tl+ ++g +W+++l  rk ++++ l +GWk+F++ + +++g f++F+++g+ +f  
  Aqcoe1G451800.1.p  25 FFKII-HPNIIKDQQLHLPNKFVRKHQND--FTDYATLKVPNGSVWNIRL--RKVGDKFCLCDGWKDFADHHSICAGHFLTFRYKGSCSF-- 109
                        55655.88889999************988..4557999************..*********************************99999.. PP

                        EEEEE- CS
                 B3  93 vvkvfr 98 
                         v++++
  Aqcoe1G451800.1.p 110 DVMICD 115
                        888887 PP

2B362.95.1e-20166257196
                        EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                        ffk+ ++s +  +  l lpk f+++h  k++e    +l d++gr+W +k+  + ++++ +l +GWk  v+an+L+eg ++vF+l++++  ++
  Aqcoe1G451800.1.p 166 FFKIKLSSIYAHREYLQLPKLFVRTHLPKTRE--ATRLIDLEGRTWYLKY--NISKQHAYLNQGWKAVVEANNLREGHVCVFELINKKHLTF 253
                        788888888888999***********544333..799*************..********************************98777776 PP

                        EEEE CS
                 B3  93 vvkv 96 
                        +++v
  Aqcoe1G451800.1.p 254 KLSV 257
                        6666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.4E-2218117IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.28E-2221116IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.97124117IPR003340B3 DNA binding domain
CDDcd100175.59E-1624115No hitNo description
PfamPF023621.5E-1425115IPR003340B3 DNA binding domain
SMARTSM010191.0E-1425117IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.4E-21161255IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.26E-19162253IPR015300DNA-binding pseudobarrel domain
CDDcd100172.13E-17165259No hitNo description
PROSITE profilePS5086314.635166261IPR003340B3 DNA binding domain
PfamPF023627.7E-17166256IPR003340B3 DNA binding domain
SMARTSM010198.1E-12166259IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MSHITSKRGG SNQVSSPVNK RKTSFFKIIH PNIIKDQQLH LPNKFVRKHQ NDFTDYATLK  60
VPNGSVWNIR LRKVGDKFCL CDGWKDFADH HSICAGHFLT FRYKGSCSFD VMICDMSTVE  120
IDYPCKSDDD GYDQSFNKVG KGKQVTSRQK PLVYAAVSPL KSRYHFFKIK LSSIYAHREY  180
LQLPKLFVRT HLPKTREATR LIDLEGRTWY LKYNISKQHA YLNQGWKAVV EANNLREGHV  240
CVFELINKKH LTFKLSVLNV L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01580.15e-25B3 family protein