PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G311600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 179aa    MW: 20450.7 Da    PI: 10.2373
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G311600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B357.82e-18941781199
                        HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                        + +++l+lp kf+++h  + +es+  ++ d+  r+W+v +  + k+gr +l +GW++F   n+LkegD++ F+l+++++ +l+v++++k
  Aqcoe1G311600.1.p  94 SHKHQLILPFKFVKQHL-P-KESMNARIVDSFERTWTVWY--KYKKGRSLLYTGWNSFWLGNELKEGDVCAFELIDKEKIKLRVSIRKK 178
                        56789********9995.3.4789****************..77778899*************************99********9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.01E-2380174IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-2181177IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.83184178IPR003340B3 DNA binding domain
SMARTSM010194.9E-1187177IPR003340B3 DNA binding domain
PfamPF023621.2E-1693178IPR003340B3 DNA binding domain
CDDcd100177.17E-1794177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MKELADLKKD KETIGAARVP YATYEIGLFG MKVGLAPETT TNTTRVITTS VAATASQTEE  60
DGDYKLTKRE KRALEAAPGF KSNYPWFAVP IVKSHKHQLI LPFKFVKQHL PKESMNARIV  120
DSFERTWTVW YKYKKGRSLL YTGWNSFWLG NELKEGDVCA FELIDKEKIK LRVSIRKK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165177KEKIKLRVSIRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5C6A31e-129A0A2G5C6A3_AQUCA; Uncharacterized protein
STRINGAquca_088_00008.11e-129(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.18e-12B3 family protein