PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G245800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family WOX
Protein Properties Length: 387aa    MW: 42147.9 Da    PI: 8.3322
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G245800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.61.9e-1753113257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        ++R+++++eq+++Le+ F++   +p ++e++++  +l    ++ +++V++WFqNr+ + k+
  Aqcoe1G245800.1.p  53 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRRIRVQLqeygQVGDANVFYWFQNRKSRSKH 113
                        89*****************99*************************************995 PP

2Wus_type_Homeobox111.93.3e-3652115265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +++RW+P+peQi+iLe++++sG+++P+++ei+ri+ +L+eyG+++d+NVfyWFQNrk+R+++kq
  Aqcoe1G245800.1.p  52 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRRIRVQLQEYGQVGDANVFYWFQNRKSRSKHKQ 115
                        579***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.45E-1247117IPR009057Homeodomain-like
PROSITE profilePS5007110.25249114IPR001356Homeobox domain
SMARTSM003891.4E-951118IPR001356Homeobox domain
CDDcd000863.37E-852115No hitNo description
Gene3DG3DSA:1.10.10.603.2E-752117IPR009057Homeodomain-like
PfamPF000464.8E-1553113IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MASSNRHWPS MFKTKPCNPH HQWQHDISPT HNIPHHQKAP YASGSEERSP DPKPRWNPKP  60
EQIRILEAIF NSGMVNPPRD EIRRIRVQLQ EYGQVGDANV FYWFQNRKSR SKHKQRSHLH  120
TSKSHTQSSS VAATTFVGPS SSSSSSEKSP PKRTNKLLQM GSSGMNIMDA ANSPTASVNQ  180
TYFQSQGDFS ADPFFYPVAQ QAGNNNTLFS SQGLCFPELS NIVQIPDQVI VPCTGFLLSE  240
LVNQNATKRY EEEEKLKLEQ QLSYSTAVTT TNSTTTTTTT TTTPNTIPSS STSVGSININ  300
QIQGGGESGA GGLGLATAAM KSTVFINNVA VEVALGPFNV RDAFGEDALL VHSSGQPVVT  360
NEWGVTLQSL QPGAVYYLVC ASNIFA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273188.11e-153PREDICTED: WUSCHEL-related homeobox 9-like
TrEMBLF6HM561e-153F6HM56_VITVI; Putative uncharacterized protein
STRINGVIT_10s0003g00560.t011e-152(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.14e-62homeobox-3