PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G196100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 487aa    MW: 55017.6 Da    PI: 9.8249
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G196100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B338.71.7e-12881681399
                        TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                        ++ l++p +f+++++g+ +   + +l+++ grsW v +  ++  + ++l + Wk F+k+n L+ g+f++   +g+s+f  +vk+++k
  Aqcoe1G196100.1.p  88 RNKLRIPMTFIKDFNGDVPD--QFKLRSLIGRSWIVSV--KQVNDDFFLCNEWKAFAKDNSLEFGEFIICIQNGNSDF--TVKICSK 168
                        456**********9666444..59999***********..8888889***********************98888999..*****98 PP

2B343.55.8e-142533341499
                        T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                 B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                         r+ +p+  a+++ ++k +    +l ++ g  W vk+    k+gr+ l++GW+eF ++n+L + D++ F+++++++   +v +++k
  Aqcoe1G196100.1.p 253 YRMGIPRWLATKCFMEKDS---TMLLNPCGMAWPVKIA-HEKDGRTCLSAGWREFFRSNDLSTDDTCCFEVIKDMDNAIRVEILQK 334
                        5899*********766544...899************6.55556788***************************999899998875 PP

3B357.82e-18397482497
                        E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                 B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                         l+ps+v++s+ l +p  fa+++ ++      ++l++++g  W+v++   k ++r  ++kGWkeFv an+LkegD++ F+l++++  el+v+
  Aqcoe1G196100.1.p 397 SLLPSYVNRSSYLNVPMLFAKTYLKDA-H--SVILRTPNGGFWRVRF---KEPCR--MGKGWKEFVVANHLKEGDVCKFELVDSNHMELMVS 480
                        578********************5553.4..5***************...66666..9***********************99999999999 PP

                        EE CS
                 B3  96 vf 97 
                        + 
  Aqcoe1G196100.1.p 481 IS 482
                        86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.0E-1773170IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.61E-1973171IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.09676169IPR003340B3 DNA binding domain
CDDcd100174.68E-1077167No hitNo description
SMARTSM010192.1E-1079169IPR003340B3 DNA binding domain
PfamPF023622.9E-1087169IPR003340B3 DNA binding domain
PROSITE profilePS5086310.771240335IPR003340B3 DNA binding domain
SuperFamilySSF1019366.28E-16242329IPR015300DNA-binding pseudobarrel domain
CDDcd100175.73E-12242318No hitNo description
Gene3DG3DSA:2.40.330.102.2E-17242333IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.5E-8243335IPR003340B3 DNA binding domain
PfamPF023621.2E-11253333IPR003340B3 DNA binding domain
SuperFamilySSF1019365.49E-20391480IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-18391479IPR015300DNA-binding pseudobarrel domain
CDDcd100171.59E-19392481No hitNo description
PROSITE profilePS5086313.394394485IPR003340B3 DNA binding domain
SMARTSM010196.3E-18394485IPR003340B3 DNA binding domain
PfamPF023621.1E-16397482IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MNEWLLNTKS TKLVNASFPT LCKNSAISLS LSLSLSLSLS RHCYKMKILK SSSFRQFPSR  60
TTNRISKVIK KEQSRQPYFV KGMIGDFRNK LRIPMTFIKD FNGDVPDQFK LRSLIGRSWI  120
VSVKQVNDDF FLCNEWKAFA KDNSLEFGEF IICIQNGNSD FTVKICSKNS CNKKVCLAKK  180
NNVESISCFR EEKQHKETAK IAKLPPQNDK ESVVDHMNSG SCMPDTQIVK TERSKALIGG  240
DSFIAHLVSS NIYRMGIPRW LATKCFMEKD STMLLNPCGM AWPVKIAHEK DGRTCLSAGW  300
REFFRSNDLS TDDTCCFEVI KDMDNAIRVE ILQKGVKGQA SAAMASSKEV NEASRTKRKK  360
ENVTDHLPSK READQLRDTE TISTTASTSI FPSCSVSLLP SYVNRSSYLN VPMLFAKTYL  420
KDAHSVILRT PNGGFWRVRF KEPCRMGKGW KEFVVANHLK EGDVCKFELV DSNHMELMVS  480
ISPAKA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5DDC50.0A0A2G5DDC5_AQUCA; Uncharacterized protein
STRINGAquca_022_00154.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.11e-13B3 family protein