PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G196000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family B3
Protein Properties Length: 431aa    MW: 49962.7 Da    PI: 7.1063
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G196000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3567.4e-1825114197
                        EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                        ffk+  +s+  + +rl++pkkf++ +g k e    ++l+ +s++ Wev+l      g++++++GW +F + + + +g f+vF++dg+s+f  
  Aqcoe1G196000.1.p  25 FFKII-HSSCIQDRRLTIPKKFIRIFG-K-ELANVVVLKVPSNKHWEVEL--VEDEGQVWFQNGWHRFMEYHSISVGHFLVFRYDGNSQF-- 109
                        56655.999999***********6666.3.4777999*************..99999******************************999.. PP

                        EEEEE CS
                 B3  93 vvkvf 97 
                         v ++
  Aqcoe1G196000.1.p 110 SVVIL 114
                        66665 PP

2B357.42.6e-18293383498
                        E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                 B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                        ++ +s+v++  ++ lp +fa+++ +++ +   +tl+ ++g++W+v++  +    r+ l kGWkeFv +n+L++ D++ F+l++ +++e++v+
  Aqcoe1G196000.1.p 293 IMHSSYVSSPFLVNLPVDFARTYLKENVQC--VTLRVSDGKRWQVQC--SSVTYRFRLMKGWKEFVFDNDLEQDDICRFELVDWKRTEMKVT 380
                        567899999999***********5444454..9999999********..7777779999*********************99669******* PP

                        EE- CS
                 B3  96 vfr 98 
                        +fr
  Aqcoe1G196000.1.p 381 IFR 383
                        *98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.2E-2519116IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-2322124IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.01524117IPR003340B3 DNA binding domain
CDDcd100173.14E-1824115No hitNo description
PfamPF023621.4E-1525114IPR003340B3 DNA binding domain
SMARTSM010191.0E-1425117IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.7E-23282383IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-21283383IPR015300DNA-binding pseudobarrel domain
CDDcd100171.35E-19288383No hitNo description
SMARTSM010191.0E-9290385IPR003340B3 DNA binding domain
PROSITE profilePS5086313.535290385IPR003340B3 DNA binding domain
PfamPF023626.7E-16292383IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0010048Biological Processvernalization response
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MQKSKIKEEQ CYQKRREEKG QGSHFFKIIH SSCIQDRRLT IPKKFIRIFG KELANVVVLK  60
VPSNKHWEVE LVEDEGQVWF QNGWHRFMEY HSISVGHFLV FRYDGNSQFS VVILDTRASE  120
IEYPCDIDCE PTMLTKNSNH VQEHDPCVHY IEGPRELMCK SEAENIKQEE CEVSGSIFKV  180
FPEAIAFDLD CPNNYTLSSP PGMLRPRSDD LHQVTNDKGV QSNIRNNTSM SKTLEVGLHC  240
NKQETRTREA SILEVQEDAQ VYECRRPVSF QEKEQPFVAA RAFTSENPIC IVIMHSSYVS  300
SPFLVNLPVD FARTYLKENV QCVTLRVSDG KRWQVQCSSV TYRFRLMKGW KEFVFDNDLE  360
QDDICRFELV DWKRTEMKVT IFRVLEYPKQ RGISAQSKSS GCNPIFLTRN KGKHNEDGNI  420
GNTSELKQKN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1626538724145B3 domain-containing transcription factor VRN1
4i1k_B2e-1626538724145B3 domain-containing transcription factor VRN1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G5DDC20.0A0A2G5DDC2_AQUCA; Uncharacterized protein
STRINGAquca_022_00155.10.0(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.19e-45B3 family protein