PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco028599.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 231aa    MW: 25141.2 Da    PI: 6.095
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco028599.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.51.8e-1075123250
                  XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                  +elk++r+   NReA r++R++Kka  + Lee+vk+L   N++L k+l+
  Aco028599.1  75 QELKKTRKPLGNREAVRKYREKKKAHAAYLEEEVKKLRLVNQQLLKRLQ 123
                  79*******************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.9E-1367141No hitNo description
SMARTSM003388.3E-1074141IPR004827Basic-leucine zipper domain
PfamPF077161.8E-1276131IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.77276123IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-877124No hitNo description
CDDcd146862.43E-979132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MDEGEVDLST HLLLPNLETS TAFDEFLRNT TTCTHTHTCN PPGPAATTHT HTCYHTHTQV  60
LSPSPEKEMS AEEQQELKKT RKPLGNREAV RKYREKKKAH AAYLEEEVKK LRLVNQQLLK  120
RLQGQAALEA EVVRLRSLLV DFRAKIDGEL GSFPFQKECG ASSVSRCNNG AAQCFLGEGE  180
VVGWEGSCGP AVLNCGNNEN GDFGRKLDIG EAVNSMDAVG SLVSSASQAE *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008788583.11e-118PREDICTED: uncharacterized protein LOC103706294
SwissprotQ8GTS26e-62BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0P0V9D36e-77A0A0P0V9D3_ORYSJ; Os01g0801901 protein
STRINGGSMUA_Achr4P10150_0011e-75(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.16e-41bZIP family protein