PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco028086.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family M-type_MADS
Protein Properties Length: 352aa    MW: 39808.5 Da    PI: 4.7424
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco028086.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.21.6e-111058250
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 rie + +    + kR++g+ KK +ELS+LC++++ ++ + + g + +++
  Aco028086.1 10 RIECDEKWRECYRKRKEGLKKKIFELSTLCGVNAFLVCYVPLGDVVTWP 58
                 6666666666899***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.4E-6159IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.367161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-17294IPR002100Transcription factor, MADS-box
CDDcd002661.21E-15285No hitNo description
PRINTSPR004043.6E-5323IPR002100Transcription factor, MADS-box
PfamPF003193.2E-111057IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MTRQRVQLKR IECDEKWREC YRKRKEGLKK KIFELSTLCG VNAFLVCYVP LGDVVTWPPD  60
DHALCELAEK YESLTAETKA KHNLNMSSYL LSEIQKQQKR LNKVTAADDL LARWNGRRLD  120
DMTEVELREL LQLLDETLER ARRRITYLYS EKCFDENIES GPCFTPPTPL ADEDLNFAHV  180
HLYGGKRFGK SLESSGAETV PCFTYPTTAL ADEDNNVTSY YGEKCSNESV ESGHAETVSW  240
LTYPTTLLAN EDDKFTTTTK TCLNHTEIPL IGYFPAEEPS AEVNFDGNNV FFPLDYNINT  300
SPLASTSGGH GPLREDRSPW AKTADWLMYF DGSWTTPFGE SKEHGDASSG V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020080835.10.0MADS-box transcription factor PHERES 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143511825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31630.12e-10AGAMOUS-like 86