PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco027746.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family HSF
Protein Properties Length: 584aa    MW: 63909.3 Da    PI: 4.8191
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco027746.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind79.74.5e-253088260
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                  Fl+k+y++++d++++ ++sw +++nsfvv+++ efa+++LpkyFkh+nf+SFvRQLn+Y
   Aco027746.1 30 FLSKTYDMVDDPATDAIVSWGRENNSFVVWNTPEFARDLLPKYFKHNNFSSFVRQLNTY 88
                  9********************999**********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004153.0E-5026194IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.104.8E-3427108IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467853.81E-232888IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000561.4E-133053IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004479.4E-2730194IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.4E-136880IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.4E-138193IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.104.8E-34162194IPR011991Winged helix-turn-helix DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MGRGGGGAAA SASAAAGPNP SLNGNAPPPF LSKTYDMVDD PATDAIVSWG RENNSFVVWN  60
TPEFARDLLP KYFKHNNFSS FVRQLNTYLQ PARTVLWGDT RYNPVMSTPE HIARGEATTL  120
EQGLKSGTGL PDLGPVPESF SRGLRRLRAM RPVSLNGTGL WGPGFRKVDP DRWEFANESF  180
LRGQKHLLKT INRRKSSHPH NETPQPKSQT AACVEVGKFG LEEEIERLKR DKNILMQELV  240
RLRQQQQATD QQLHTLGNRL QGMEQRQQQM MSFLAKAMQS PGFLAQFMQQ NDSNKRIAAA  300
SKKRRLPKQE AGLDAGSNSP DGQIVKYQPM INEAAKAMLR QILKLDGSSP PRLEQLSNSD  360
NFSLENFMPP SEATTFDSTS SNRNSGVTLA EVPSGLSVPY VTASTGFSAI CSSSAASEIQ  420
SPIGLSDNKN SSEELRDMDV LSSVPETIPS PSPTDMSVPE FSELQDIVSE DSVVNIPGES  480
FVGAYINPIA EVEADNAVPI ETDDILYGDD EQKLPGIIDT FWEQFLASSP ISSEAVEEVE  540
LSGQEGKAVM QQRPQNSNNG WDSARNMENL TEQMGLLSSD RKG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B4e-18188387Heat shock factor protein 1
5d5v_B4e-18188387Heat shock factor protein 1
5d5v_D4e-18188387Heat shock factor protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by heat stress. {ECO:0000269|PubMed:18064488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6653091e-59KM665309.1 Ananas bracteatus clone 50408b microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020089587.10.0heat stress transcription factor A-1-like isoform X1
SwissprotQ84T611e-168HSFA1_ORYSJ; Heat stress transcription factor A-1
TrEMBLA0A199UEJ30.0A0A199UEJ3_ANACO; Heat stress transcription factor A-1 (Fragment)
STRINGTRIUR3_08676-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP50973151
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32330.19e-85heat shock transcription factor A1D
Publications ? help Back to Top
  1. Chauhan H,Khurana N,Agarwal P,Khurana P
    Heat shock factors in rice (Oryza sativa L.): genome-wide expression analysis during reproductive development and abiotic stress.
    Mol. Genet. Genomics, 2011. 286(2): p. 171-87
    [PMID:21792744]