PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco026062.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 125aa    MW: 13730.6 Da    PI: 8.7929
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco026062.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.26.5e-0721622263
                 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1 22 qRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                   Kk+ +  L+++v +L +eN++L+ke+e l   +a+  +e+
  Aco026062.1 21 PGKKKALPDLQKEVRSLVEENEMLRKEAEDLHRACAAASAEN 62
                 55999999***************************9877766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.0E-42053No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MIGRQPLIRR FQTPPAKNPR PGKKKALPDL QKEVRSLVEE NEMLRKEAED LHRACAAASA  60
ENRTLQLRLD QRNTPIRSDS PAPRAKQEPD APPRAAPPPL VQCDDGEGGG FRIPDLNLPA  120
SDDL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951