PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco025328.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family HRT-like
Protein Properties Length: 414aa    MW: 46776.3 Da    PI: 9.6887
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco025328.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like45.61.1e-14262292131
     HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                  iCG+  + G vC++ Pv+gRKRC eHKG+Ri
  Aco025328.1 262 ICGMPVSGGAVCRNRPVQGRKRCDEHKGKRI 292
                  8*****************************7 PP

2HRT-like50.33.9e-16311341131
     HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                  +CG+iledG+ C++ Pv+gRKRCe H G+Ri
  Aco025328.1 311 TCGFILEDGTSCMEIPVRGRKRCELHRGRRI 341
                  7*****************************7 PP

3HRT-like521.2e-16382412131
     HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                  iCG++++d  vC+++Pv+gRKRCe HKG+Ri
  Aco025328.1 382 ICGIAIDDNLVCTNKPVQGRKRCELHKGRRI 412
                  8*****************************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MPSRLKREDC PRTKHDSVFS PWKVLIGPSD WEDHLSGKDG VQRYRIHNLP ANCSCPGLYE  60
LGVATTIPDE GRWTRKHDLD DIVVVYLGQA DNLRTRLQHY GRTGSHLDYG NSLTCSSKNG  120
SPCFTAGPGL FREIFSKGYS LVFRWVQMTN KVVAERAEAK LLEVFDYAWN KLQNGAYRRE  180
EILAKLDNAA SRRSPSSISK LQQFKHIMFD KKVGIGINEN GSVDTPESFM GYRNLLPQVL  240
KFGNHRPQSV RVSDNFTKDD NICGMPVSGG AVCRNRPVQG RKRCDEHKGK RIPLLIPVIE  300
KEGTPQETSS TCGFILEDGT SCMEIPVRGR KRCELHRGRR IVSPKIRDFS DRSPFNHLEP  360
PLSGHGKDWK IGARKHYDEH VICGIAIDDN LVCTNKPVQG RKRCELHKGR RIT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020083922.10.0protein EFFECTOR OF TRANSCRIPTION 2-like isoform X1
TrEMBLA0A199W6Y20.0A0A199W6Y2_ANACO; Uncharacterized protein (Fragment)
STRINGGSMUA_Achr8P21880_0011e-122(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79483443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.13e-87effector of transcription2