PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco024142.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 207aa    MW: 23314.3 Da    PI: 10.1399
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco024142.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1506.5e-16122175356
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                  +++r+rr++kNRe+A rsR+RK+a++ eLe  v++Le+eN +L ke e  k + 
  Aco024142.1 122 AVRRQRRMIKNRESAARSRERKQAYTLELESLVAQLEEENARLLKEKEDFKRLR 175
                  689******************************************999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000415.9E-6119135IPR001630cAMP response element binding (CREB) protein
SMARTSM003381.0E-13120184IPR004827Basic-leucine zipper domain
PfamPF001702.6E-14121173IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.404122173IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.98E-11123173No hitNo description
CDDcd147071.27E-19124173No hitNo description
Gene3DG3DSA:1.20.5.1704.5E-14124173No hitNo description
PROSITE patternPS000360127142IPR004827Basic-leucine zipper domain
PRINTSPR000415.9E-6137157IPR001630cAMP response element binding (CREB) protein
PRINTSPR000415.9E-6157174IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MASPAVDSDV ARPISPYPLS VEDLPASTSD RSQTLRSMGD LLRSIHGAGG GGVRGGDQDE  60
DEAYGEMTLE DFLARAGAVK KEEEDDARVL PENPVLGFGG EERRRRGRRR KRPVLDPIDN  120
AAVRRQRRMI KNRESAARSR ERKQAYTLEL ESLVAQLEEE NARLLKEKED FKRLRLKEIK  180
ENIIPLTEKK TPARPSPLRR TQSSKW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101112ERRRRGRRRKRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6624476e-99KM662447.1 Ananas bracteatus clone 46183 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010911997.18e-49PREDICTED: G-box-binding factor 4-like isoform X1
RefseqXP_010911998.18e-49PREDICTED: G-box-binding factor 4-like isoform X1
RefseqXP_010912001.18e-49PREDICTED: G-box-binding factor 4-like isoform X1
RefseqXP_010912002.18e-49PREDICTED: G-box-binding factor 4-like isoform X1
TrEMBLM0SGW34e-48M0SGW3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P22470_0011e-47(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.12e-27bZIP family protein