PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco023735.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 163aa    MW: 17613.7 Da    PI: 8.3519
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco023735.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.93.8e-123383555
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
                 ++++r+ +NRe+ArrsRqRK++ ++eL   v +L++e  +  + +   +++
  Aco023735.1 33 RKQKRMLSNRESARRSRQRKQKHLDELMASVNQLQKEKAQILSAIAFTSQH 83
                 79************************************9988877655555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.0E-162993IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.0133194IPR004827Basic-leucine zipper domain
PfamPF001705.7E-103276IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-103379No hitNo description
SuperFamilySSF579593.66E-113387No hitNo description
CDDcd147027.04E-163485No hitNo description
PROSITE patternPS0003603651IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MASSSGTSSG SSSAQLQNSA SSEEDLRALM KQRKQKRMLS NRESARRSRQ RKQKHLDELM  60
ASVNQLQKEK AQILSAIAFT SQHHALLEAD NSVLRTQAVE LRSRLQSLDH ILCFLNGTGS  120
TAPSSDESYY AGFEASESCM RHHPLVASAD IGGGGACDVC ML*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14551RRSRQRK
24552RRSRQRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6636991e-161KM663699.1 Ananas bracteatus clone 48236b microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936666.13e-45PREDICTED: ocs element-binding factor 1-like
TrEMBLW9SFP21e-40W9SFP2_9R
STRINGGSMUA_Achr1P25340_0012e-38(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44593367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.12e-32basic leucine-zipper 44