PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco023268.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family GRF
Protein Properties Length: 389aa    MW: 43310.7 Da    PI: 7.9656
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco023268.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.56.5e-2583126144
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  Aco023268.1  83 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 126
                  79***************************************997 PP

2QLQ62.31.3e-211045237
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                 +FT++Q+q+L++Q+l+yKy++++ P+P++L+++i++
  Aco023268.1 10 PFTPSQWQELEHQALIYKYMVSGIPIPSDLILPIRR 45
                 9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.7E-12945IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.7371045IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.0E-161044IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.50483127IPR014977WRC domain
PfamPF088792.1E-2084126IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MMSGRSSRYP FTPSQWQELE HQALIYKYMV SGIPIPSDLI LPIRRSFLLD STITSPSLAL  60
PPHQPPSLGW GCFQLGYGRK AEDPEPGRCR RTDGKKWRCS KEAYPDSKYC EKHMHRGKNR  120
SRKPVEISLA NSSSSSSSSS SSSSSSSSSS SSSSSSSSSS SSSSSSSSLS HGLSHYPSSL  180
SISAAPEPHH HLLYPYYGTR PPFHWDNTSP YSAEKDYRLH YQDNESTCTH GRYGHGMKDE  240
YSFVSEASAG GRESSWQFRP LGMSSLGDPK HGSNELFKEA EEEEAKQQQH CFILGADFKL  300
EKPAKTERAE HGEGQKPLRH FFDEWPPQKS KDSWMDLEGE NASLAYSKTQ LSISIPMAHH  360
DFSIAAPRYR NGSHLLHANN MNEVSRAF*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020083114.10.0growth-regulating factor 1-like
SwissprotQ6AWY82e-99GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLA0A199USX50.0A0A199USX5_ANACO; Growth-regulating factor 1 (Fragment)
STRINGOB02G41370.11e-101(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-55growth-regulating factor 5