PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco022101.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family M-type_MADS
Protein Properties Length: 268aa    MW: 29595.1 Da    PI: 8.469
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco022101.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.83.3e-191150342
                 --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
       SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                 i+n+s r  tf kRr+g++KKA+EL +LCd++++v+++++
  Aco022101.1 11 ISNDSTRRATFKKRRKGLMKKASELATLCDVRACVVVYAP 50
                 9*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.334149IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-23160IPR002100Transcription factor, MADS-box
CDDcd002661.56E-34285No hitNo description
PRINTSPR004046.4E-11323IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-25394IPR002100Transcription factor, MADS-box
PfamPF003191.1E-181151IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MARKKVNLAW ISNDSTRRAT FKKRRKGLMK KASELATLCD VRACVVVYAP GEAQAEVWPS  60
PAEAARVLAR FKSMPEMEQC KKMMNQEGFL RQRVAKAQEQ LRKQERENRE LETTLLMYDG  120
LNSVAEGAGA GAVGRLRDLG IEDATSLAWM VEMKAKAVQE RIDILKAQMH HAPSAAAGAA  180
TSSSSHAAAA IQQHQGPTDA LVTKDKTPLE AAMEALQRQN WFMEVMNPSI DNNVLFGGVS  240
GPAEEMMLMQ PYIETTMPWL DPYFPLN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVNLAWISNDSTRRATFKKRR
22125KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020087252.10.0agamous-like MADS-box protein AGL80
TrEMBLA0A199V9M70.0A0A199V9M7_ANACO; Agamous-like MADS-box protein AGL80
STRINGXP_008800341.11e-113(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-39AGAMOUS-like 80