PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco021677.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 523aa    MW: 57054.1 Da    PI: 10.9597
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco021677.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.59e-11376434563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr +r   NR +A rs +RK  +i eLe kv+ L++e ++L  +l  l+  +a l+s++
  Aco021677.1 376 KRVKRILANRQSAARSKERKMRYISELEHKVQILQTEATTLSAQLTLLQRDSAGLTSQN 434
                  899**************************************************999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-18372436IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76374437IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-11376433No hitNo description
PfamPF001708.7E-10376434IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.04E-11376427No hitNo description
CDDcd147037.74E-23377428No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 523 aa     Download sequence    Send to blast
MPKLVSRGAA NRRSVRAVPP RGDGPRSFGP IGFPRPPQMP LCPLRLRFGF ASASVRLRLL  60
PPPTSHILRP PPPMALALAA ALAVAVPPAF FSLDSLPPLS PSPSPSPSPS PARRRRSAVG  120
PRRRSAGRRR RAAEPRGSRP ARRTAAPTAT SPSGSSPPPP LPPRPSPHPP PPLPHRTGHG  180
LFDASPRRPP LSPPPPPPQQ PFVKQESSDW EREANSNADG DDLFNAYMNL DSLETLNSSG  240
NTEDKREDLD SRASGTRTNN DSSDNEAESS VSEKLPTGKK EGTKRSASGD PVPVNPRHVR  300
SVSVDSFMGK LNFEDESPKP SPSPGGQAGL LTRSGSLDEN TNEFNLEFGN GEFSPAEMKK  360
IMENDKLAEM ALTDPKRVKR ILANRQSAAR SKERKMRYIS ELEHKVQILQ TEATTLSAQL  420
TLLQRDSAGL TSQNNELKFR LQAMEQQAQL RDALNEALTA EVQRLKLATG EISEAHLSKG  480
LNQQISLNSQ IYQLQQLQLQ QQQHQQQQQQ QNNSNAKPDQ NK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113130RRRSAVGPRRRSAGRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010923730.11e-146PREDICTED: probable transcription factor PosF21
RefseqXP_010923731.11e-146PREDICTED: probable transcription factor PosF21
RefseqXP_010923732.11e-146PREDICTED: probable transcription factor PosF21
TrEMBLA0A068TM071e-135A0A068TM07_COFCA; Uncharacterized protein
STRINGVIT_03s0038g00860.t011e-133(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-83bZIP family protein