PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco019811.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family LBD
Protein Properties Length: 185aa    MW: 21419.8 Da    PI: 6.9885
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco019811.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.17.1e-39191191101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C++dCvlapyfp + p++f +vh++FGasnv ++l++lp ++r +a+++l  eA +r+rdPvyG+vg+i+ lqq++   ++ela+++
  Aco019811.1  19 RCAACKYLRRRCSEDCVLAPYFPPSLPERFTCVHRIFGASNVARMLQQLPAHQRAQAADTLSLEAYWRVRDPVYGSVGIINLLQQEIYGNQHELARTQ 116
                  6***********************************************************************************************99 PP

       DUF260  99 eel 101
                  +++
  Aco019811.1 117 AQI 119
                  885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.78318119IPR004883Lateral organ boundaries, LOB
PfamPF031956.4E-3819116IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MSISNSNNNL ALNEFNPRRC AACKYLRRRC SEDCVLAPYF PPSLPERFTC VHRIFGASNV  60
ARMLQQLPAH QRAQAADTLS LEAYWRVRDP VYGSVGIINL LQQEIYGNQH ELARTQAQIA  120
MYRAQHDHHH HHHHQQQQQQ QQEQRETADG AHEPVEPTPF LGPPQQDNCA LERTFLESNH  180
FPDFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-332012212114LOB family transfactor Ramosa2.1
5ly0_B1e-332012212114LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020092109.11e-137LOB domain-containing protein 23-like
SwissprotP594676e-48LBD23_ARATH; LOB domain-containing protein 23
TrEMBLA0A199VDB41e-135A0A199VDB4_ANACO; LOB domain-containing protein 23 (Fragment)
STRINGXP_008801576.16e-68(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-49LOB domain-containing protein 24