PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco019026.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family M-type_MADS
Protein Properties Length: 96aa    MW: 10838.7 Da    PI: 8.766
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco019026.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF23.95.3e-081652844
                 HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
       SRF-TF  8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                  r+ t+ kR   +    eEL vLC+a++ +++fs++g
  Aco019026.1 16 HRKKTYRKRHPVLKRRVEELGVLCEADAVLLMFSPSG 52
                 58889****9999999*******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.9E-4160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.105161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-12161IPR002100Transcription factor, MADS-box
PfamPF003193.0E-91754IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MGYTKVPMEA RDTLHHRKKT YRKRHPVLKR RVEELGVLCE ADAVLLMFSP SGNPLMLTIS  60
SFLVESLQWQ ALLDHCVDGF HVVVSVLDFN VRGGF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020108680.15e-33agamous-like MADS-box protein AGL30
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.13e-09AGAMOUS-like 65