PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco018680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family LBD
Protein Properties Length: 201aa    MW: 20949.9 Da    PI: 8.708
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco018680.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.42.8e-39231221100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk++rr+C+++C++ pyf  ++p+kfa vhk+FGasn +k+l+ +pe++r da+++lvyeA++r++dPvyG++gvil+lqqq++ l+ael ++k
  Aco018680.1  23 PCAACKFMRRRCTQQCPFFPYFSPHEPQKFASVHKVFGASNASKILSVVPESQRADAANTLVYEANMRLQDPVYGCTGVILALQQQVQALEAELGAVK 120
                  7*********************************************************************************************9988 PP

       DUF260  99 ee 100
                  +e
  Aco018680.1 121 AE 122
                  75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.43422123IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-3923120IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MAQRPPLGPA GGMLSTALNT VTPCAACKFM RRRCTQQCPF FPYFSPHEPQ KFASVHKVFG  60
ASNASKILSV VPESQRADAA NTLVYEANMR LQDPVYGCTG VILALQQQVQ ALEAELGAVK  120
AEVLKYKYRP TAVATATILP PSTSHAAAFL ATAAGLSVTA PPPLATATPA PASSSSSMYT  180
AASSSTDYSS VTNENAPYFG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-412312611114LOB family transfactor Ramosa2.1
5ly0_B1e-412312611114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020103786.11e-144LOB domain-containing protein 15-like
SwissprotQ8L5T51e-59LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A199UPS91e-113A0A199UPS9_ANACO; LOB domain-containing protein 15 (Fragment)
STRINGGSMUA_Achr5P07460_0012e-91(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.15e-54LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]