PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco018015.1
Common NameMADS2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 215aa    MW: 24368.1 Da    PI: 6.8541
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco018015.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.62.2e-25956148
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                 krien   rqvtf+kRr+g+lKKA ELSvLCda++ +iifs++gkly+
  Aco018015.1  9 KRIENPVHRQVTFCKRRAGLLKKARELSVLCDADIGIIIFSTHGKLYD 56
                 79********************************************97 PP

2K-box30.81.2e-11851601286
        K-box  12 akaeslqqelakLkkeienLqreqRhllGedL.esLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                  ++ ++ ++e+  Lk+ei+ Lq+ +R + G+   e + l+eL  Le++Le  + +iR+ K+ +l++  e lq+k  e
  Aco018015.1  85 SQPQEPEHEVMMLKQEINLLQKGLRYMFGDRTaEHMALEELLALERHLEIWMYNIRAAKEGILKATNELLQEKIVE 160
                  56788999*********************975278************************************99655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.2E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.702161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-27174IPR002100Transcription factor, MADS-box
CDDcd002655.58E-41275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-273859IPR002100Transcription factor, MADS-box
PfamPF014865.1E-1386157IPR002487Transcription factor, K-box
PROSITE profilePS512979.21987177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KARELSVLCD ADIGIIIFST HGKLYDLATK  60
GTMEGLIERY KNACGEVHAE GGELSQPQEP EHEVMMLKQE INLLQKGLRY MFGDRTAEHM  120
ALEELLALER HLEIWMYNIR AAKEGILKAT NELLQEKIVE QNGFFDIAPV IAQQNGHFAV  180
APVIGDHHHI PYNPLTIQND YYSSCRGSEM GYSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6bz1_A2e-15197185MEF2 CHIMERA
6bz1_B2e-15197185MEF2 CHIMERA
6bz1_C2e-15197185MEF2 CHIMERA
6bz1_D2e-15197185MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2574090.0KC257409.1 Ananas comosus MADS-box transcription factor (MADS2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020084625.11e-157MADS-box transcription factor 26-like isoform X1
SwissprotA2YQK91e-101MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-101MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLM4MBK51e-155M4MBK5_ANACO; MADS-box transcription factor
STRINGTRIUR3_13653-P11e-103(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-52AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]