PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco017998.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 411aa    MW: 44170.8 Da    PI: 6.9499
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco017998.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.11.2e-10218276563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr++r   NR +A rs +RK+ +i+eLe+kv++L++e ++L  +l  l+     l++e+
  Aco017998.1 218 KRAKRIWANRQSAARSKERKLRYIAELERKVQALQTEATTLSAQLTLLQRDTTGLTAEN 276
                  9********************************************99998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.9E-16214278IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.703216279IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-10218272No hitNo description
SuperFamilySSF579591.2E-10218270No hitNo description
PfamPF001703.6E-9218272IPR004827Basic-leucine zipper domain
CDDcd147031.00E-23219268No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MMNKDKSPVQ GGGAGAHYAA YGSPSGGFAP MADPSPPSSS SSAHAGHDEA GRYSHDISRM  60
PDFPPRNRGH RRAQSEILSL PDDITFDSDL GFVGSHDGPS LSDENDDELF SMFIDVEKLN  120
FATSEGESSG NVVAPHLPTT TAAAASGAVA AWPSEAESSA AGSRERPRPR HQHSQSMDGS  180
TSIKPELLGS SGEGPLLPDA KKAMSAAKLA DLALVDPKRA KRIWANRQSA ARSKERKLRY  240
IAELERKVQA LQTEATTLSA QLTLLQRDTT GLTAENNELK LRLQTMEQQV HLQDALNDAL  300
RDEVQRLKHA TGQMPNGGAA AMMNFAPPHS FGTSQQFYHH NQAMQSILTA RQLQQLQIHS  360
QHQQPPPLQH PPQHLHLQDP LANPRMKGSS SSSSSSLSQR AEGKSDSNST *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6653830.0KM665383.1 Ananas bracteatus clone 50514b microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930253.11e-151PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-122POF21_ARATH; Probable transcription factor PosF21
TrEMBLM0RSC91e-150M0RSC9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P14990_0011e-149(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-103bZIP family protein