PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco016741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 417aa    MW: 45914.1 Da    PI: 9.076
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco016741.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.31.4e-07144206163
                  XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  eke kr rr   NRe+Ar   +R++a  eeL++kv+ L+ eN+ +k + e  ++e+ +lk+ +
  Aco016741.1 144 EKEAKRLRRVLANRESARQTIRRRQALREELTRKVADLSLENQNMKMKKEIATEEYLALKDTN 206
                  89**********************************999998888888888888888888766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.0E-4140205No hitNo description
PfamPF001701.7E-6144206IPR004827Basic-leucine zipper domain
SMARTSM003381.8E-7144208IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.415146209IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.08E-5148204No hitNo description
CDDcd147027.41E-12149199No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MEGEREETGG AGPNPNPSSS GAGSRGQCRS GGMVEVELDA ARALADMAAI GERSGEKRTR  60
KRAENESSGP DSVQAKSSHE PSSGSEHSYL VRDHREGKRI QAEAEKEPKN LQLSVELSKL  120
GIHCSASQTP LFGSRGKQNL TEAEKEAKRL RRVLANRESA RQTIRRRQAL REELTRKVAD  180
LSLENQNMKM KKEIATEEYL ALKDTNKRLK AQETKWDAVA KTEPAPQPVQ TTVASPTKRS  240
AALHSTQPLV PYIWRSLPAR GACYEQGNPS VSGPGPPFSL PPCAWFYPLV HEVPQPSALY  300
SHASRDQYVS SSSAQHSFKE NRPSPAVEEE EEEEEVPCSL TLAIDEGKKA TIYDIQRKSV  360
SDQHVKNVQR ETEGGRSYSH EESANAAVVA AAAEARKRRK ELTKLKQMHG RQFGFQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1395400RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.18e-20bZIP family protein