PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco016587.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 493aa    MW: 53071.9 Da    PI: 6.4645
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco016587.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.95.8e-10341399563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr +r   NR +A rs +RK  +i+eLe+kv+ L+ e ++L  +l  l+  +a l s++
  Aco016587.1 341 KRVKRILANRQSAARSKERKMRYIAELEQKVQILQREATTLSAQLTLLQRDSAGLASQN 399
                  899**********************************************9999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-16337401IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.795339402IPR004827Basic-leucine zipper domain
PfamPF001701.0E-9341399IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.85E-11341392No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-10341398No hitNo description
CDDcd147033.76E-24342393No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MSESHNNAIM QPSHGSLSLS IPSNGPYGHF SGPEPGAGAG ANKRAGFPPT PPFPARSASP  60
HGFGPGPVHA RSASQPGFFS LDSLPAMAPP PPHSSSSATF SDSSPDAAMD DLAAAPSAHP  120
LLPKPSPGLP PRKAHRRSRS DVPFAHFQPS IPLAPPSHVK VEANWGFDSN GAEERKHEGG  180
ELGDDLFNAY LNLDGLDALN SSEEKHDDLD SRGSSIKTNG ADSSENEAES SANDGGSGMR  240
LWPSRSPAME PERREGAKRN AVGDPVIAGA RHRRSLSMDS LMGKLNFGEE SLGQQGAQIN  300
LANGALNKFS LEFGNGEFTP AEMKKIMAND KLAEMALADP KRVKRILANR QSAARSKERK  360
MRYIAELEQK VQILQREATT LSAQLTLLQR DSAGLASQNN ELKLRLHAME QQAQLRDALN  420
EALTAEVQRL KIACAEIGDS RSSNSLTQQM RAHSQNQMFQ LLQQQQQQEP NLFYQLQQPQ  480
QNGSATNDEL EE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008803311.11e-151PREDICTED: transcription factor RF2a-like
TrEMBLA0A0A9D7S71e-143A0A0A9D7S7_ARUDO; Uncharacterized protein
STRINGSb01g048710.11e-141(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-79bZIP family protein