PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco016259.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family GATA
Protein Properties Length: 508aa    MW: 53595.6 Da    PI: 6.6087
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco016259.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.83.6e-19422456135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  Aco016259.1 422 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 456
                  *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577163.9E-14415477No hitNo description
SMARTSM004012.7E-18416470IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.004416452IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.7E-15420454IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.28E-14421463No hitNo description
PfamPF003203.7E-17422456IPR000679Zinc finger, GATA-type
PROSITE patternPS003440422447IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MGRWNRAFVT PTDFGSHSML HQTLIPSSSS SSSSASLFPF SSPSSPLPLP LRLLRHPPPP  60
PTPPPMVYSS SQVVEKETNM ELLSSCRGEV ASLQQQQQQQ QGFGVAEEGG FMERANFVVE  120
GFSVDELLDL GEFAEPEQDE EEAEAETVEA LEAEAGCGET ELHTESSNSG SLINSSVSTS  180
PLPFDPPPPS DDFLPEHDAK EFEWVSLLMD DTLSEMPPPC AAAPPRPAAA AAVPSPTVCA  240
LATEAFAPVK AKRSKRSRGG GGGSGGGGGA AWSLSSSGGG GGSSSAPFSD SSSSSSSTTT  300
STATTTSSCS SSPPLSSLLV YDLPLVGASS DPGLFLLHDS SDSDNPPLLP PPPRKLKLSP  360
PNNNNINNNN NNNNNSKQKP KKKRGRKPKH HHHNHHKYQQ HQGLPPPPPP ASQIPAAGER  420
RCSHCGVQKT PQWRAGPEGA KTLCNACGVR YKSGRLLPEY RPACSPTFVS DVHSNSHRKV  480
LEMRRKKEAA ILLPSVPAAA PLPVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0605742e-70AK060574.1 Oryza sativa Japonica Group cDNA clone:001-023-D04, full insert sequence.
GenBankAK0991442e-70AK099144.1 Oryza sativa Japonica Group cDNA clone:J023055K24, full insert sequence.
GenBankAK1196112e-70AK119611.1 Oryza sativa Japonica Group cDNA clone:002-117-F12, full insert sequence.
GenBankAL6065872e-70AL606587.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0011L07, complete sequence.
GenBankAP0149602e-70AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126122e-70CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8551972e-70CR855197.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: H0115B09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020085428.10.0GATA transcription factor 5-like
TrEMBLA0A199UTT01e-143A0A199UTT0_ANACO; GATA transcription factor 5
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-39GATA transcription factor 5