PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco015741.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TCP
Protein Properties Length: 316aa    MW: 32550.7 Da    PI: 6.6128
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco015741.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP114.41.5e-3569147684
          TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasn 84 
                   r++++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti WLl  a+pai ++tgt++ +a ++++++   +  +
  Aco015741.1  69 GRTKDRHTKVEGRGRRIRMPAACAARIFQLTRELGHKSDGETIRWLLHHAEPAIVAATGTGTVPAIATTSVDGALKFPT 147
                  59**********************************************************8888855533333333331 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136926.37471125IPR017887Transcription factor TCP subgroup
PfamPF036343.9E-2971306IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MMDSSHSGKK DKPGGGEDGG HQRAIMPKPE AAAMGLAAVP KAEPMEVMGT NIQMMRGAGA  60
GAGAGAAAGR TKDRHTKVEG RGRRIRMPAA CAARIFQLTR ELGHKSDGET IRWLLHHAEP  120
AIVAATGTGT VPAIATTSVD GALKFPTHAP SPSPSPSSSA AGDKRRKLQP SRVSGIGAAA  180
GYYTIHDPLL PGGGAISISA GLAPILAGAG AGWVIPPGAL WMIPPPHAVA AAAAAAAAPG  240
PSTLWALPPG SQIVNFAAAE PKSPKSPKQQ QQQQQQQREL QLMAEPAKDR RKGEDEEEKE  300
EEEEEEEEEE SGAEE*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00635PBMTransfer from PK14653.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020096734.10.0transcription factor PCF2-like
SwissprotA2YXQ14e-55PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH64e-55PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A2H3X0J71e-80A0A2H3X0J7_PHODC; transcription factor PCF2-like
STRINGXP_008776516.12e-81(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.16e-41TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]