PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco015692.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 328aa    MW: 35569.9 Da    PI: 4.3926
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco015692.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.22.3e-10156204452
                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                  +k+ rr ++NR +A +sR+RKk++++eLe k   Le+e ++L   l+  
  Aco015692.1 156 SKKRRRQMRNRDSAMKSRERKKMYVKELEIKTRYLESECRRLSYALQCC 204
                  6999**********************************99998777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-7152217IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.4E-14154216No hitNo description
PROSITE profilePS502179.91155218IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-11157215No hitNo description
PfamPF001704.5E-8157211IPR004827Basic-leucine zipper domain
CDDcd147041.85E-16158209No hitNo description
PROSITE patternPS000360160175IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MDGAVVEALK EDDVLLADFD VEHLLAGFSD DLDASDLWAP ICAPPPPECE SANSTTSDPS  60
PAGGGDSPPS SISISPYVSE IERFLLEEEE GEGEGEEDGE GFDDAFLAGF FADASDDVGS  120
EGAAAGEENV EESAGSGDEK RGSADVVDVE GDDPISKKRR RQMRNRDSAM KSRERKKMYV  180
KELEIKTRYL ESECRRLSYA LQCCTAENMA LRHRLHAEGP LGAHVAVQES AVLFVESLLL  240
GSLYWLVSIV CLFLTPALPG PKDPRTPGSP GRDLSQEAAV AGKISNEKLG FNLGSELVLM  300
RRRCRSLKRR MKFSSLFPLR PISFHLV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157176KRRRQMRNRDSAMKSRERKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010913870.18e-80PREDICTED: bZIP transcription factor 60
TrEMBLM0S1D34e-68M0S1D3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P19750_0011e-67(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69343750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.12e-11basic region/leucine zipper motif 60