PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco015492.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family M-type_MADS
Protein Properties Length: 164aa    MW: 18661.9 Da    PI: 11.7942
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco015492.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.36.5e-3191141151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                  krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye+ss
  Aco015492.1  91 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFSS 141
                  79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.12783143IPR002100Transcription factor, MADS-box
SMARTSM004326.3E-4283142IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-3185105IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.62E-3085149IPR002100Transcription factor, MADS-box
PROSITE patternPS00350085139IPR002100Transcription factor, MADS-box
CDDcd002654.04E-3985146No hitNo description
PfamPF003192.1E-2792139IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-31105120IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-31120141IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MAPLFTIAPR LLFRLFSNKG RIRKGVFFFV VPSRIPNKGF PSLDQKNSPF CTPPLFSPRL  60
LPFLGLLEVR LLGWGEEEGA ERMVRGKTEI KRIENATSRQ VTFSKRRNGL LKKAFELSVL  120
CDAEVALIVF SPRGKLYEFS SSRFHRKMTK PRGDRSRTSS IQN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A2e-1785150267Myocyte-specific enhancer factor 2A
3mu6_B2e-1785150267Myocyte-specific enhancer factor 2A
3mu6_C2e-1785150267Myocyte-specific enhancer factor 2A
3mu6_D2e-1785150267Myocyte-specific enhancer factor 2A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2139153e-54AC213915.1 Oryza minuta clone OM__Ba0240A18, complete sequence.
GenBankAC2158143e-54AC215814.1 Oryza minuta clone OM__Ba0123B04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020084131.12e-99uncharacterized protein LOC109707344 isoform X2
TrEMBLA0A199ULK79e-49A0A199ULK7_ANACO; Agamous-like MADS-box protein AGL14
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.16e-36AGAMOUS-like 14