PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco015030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 211aa    MW: 21990.8 Da    PI: 10.7528
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco015030.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.25.6e-16140182547
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                  +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lk 
  Aco015030.1 140 RRQKRMIKNRESAARSRARKQAYTHELENKVSRLEEENERLKR 182
                  79**************************************994 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-14136208IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.634138183IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.06E-11140185No hitNo description
PfamPF001702.6E-13140183IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.4E-15140184No hitNo description
CDDcd147071.83E-20140186No hitNo description
PROSITE patternPS000360143158IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGTQAVAAAA AAASHGGGGG GGGRRKPQGL QGFSAQSPIY GFDEFLHTAI PPSAVAGGAE  60
MTLEGFLMKV GATAGDGGGD EGANLGRGAL SGGYVGRAGP ARQLSEAAPQ ALRRKRGAGT  120
AAVAVAVAGV EEVAEKTVER RQKRMIKNRE SAARSRARKQ AYTHELENKV SRLEEENERL  180
KRQKELEPVI HFVPQPEPKH QLRRTSSALF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009414226.16e-43PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_009414227.16e-43PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_009414228.16e-43PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_009414229.16e-43PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLM0TSF93e-42M0TSF9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P21560_0011e-41(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44413367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.17e-33ABA-responsive element binding protein 3