PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco014967.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 674aa    MW: 71642.9 Da    PI: 7.6738
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco014967.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.41.6e-13166228163
                  XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  e e+kr  r+++NRe+A+ sRqRKk ++eeLeekvk++ +   +L  +++ +  e  +l+++v
  Aco014967.1 166 EDEDKRKARLMRNRESAQLSRQRKKLYVEELEEKVKSMHSTINELNAKISYIMAENLALRQQV 228
                  6799*************************************99******99999999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-14166230IPR004827Basic-leucine zipper domain
PfamPF001708.7E-11166228IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.266168228IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-12170228No hitNo description
Gene3DG3DSA:1.20.5.1706.7E-16170228No hitNo description
CDDcd147044.27E-21171221No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MAEPALLAPS SFDLPHHNHR DAAIDPSDPP FFDPDLFSDD LPLPADPSFD DFDIDVDFSV  60
DDFLLSPERR DGSPSPEFNE GSGASSSSLP PASAADAGGG PASPDSGHSA AGSPDSGVCA  120
EGSGKARRGV KRKKQKEDAG SPNPNPSPNI SPESNSASCV DDAGDEDEDK RKARLMRNRE  180
SAQLSRQRKK LYVEELEEKV KSMHSTINEL NAKISYIMAE NLALRQQVGG NAGPNCPPQS  240
VYPMAPLHFP WIPGYSLRQQ GSQVPLVPIP RLKPQQPAPA PKAKKSESKK GEKSRTKKLA  300
SISLLGLLFV ALFFGAVVPG VTRRIGESRN SVSDQFDVGK SGNFGGSHGR VLSVSSRGGS  360
SNSTDQIELC GGKFNFGESG TDGITGKKCQ PGISKNSSES LPALLYVPRN GKHVKINGNL  420
IIHSVLASER AMAHRESRDQ VRQSTSKENN DTSLALASYV ASSLAVSESG KEMGKHFNSY  480
RGSVEHLRAL ASDSGDAHGK NMKSSLPDGS LPQWFSEGMA GPILSSGMCT EVFQFEVSPA  540
SAQPSGIVPA TSIANASSIL NSTENLHRSR HTGKIKNRRI MYKDPIPLTG KTLNNTEKPS  600
ESQNSHDNKL VSSVVVSILA DPREAGDGDG GDGRISSPKS LSRIFVVVLL DSVKYVTYSC  660
VLPFKSSGPH LVN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126132RRGVKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6656651e-139KM665665.1 Ananas bracteatus clone 50844 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010909305.10.0PREDICTED: uncharacterized protein LOC105035446
TrEMBLM0RV990.0M0RV99_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P25190_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82283545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10800.15e-59bZIP family protein