PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco014284.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 124aa    MW: 14248.9 Da    PI: 10.824
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco014284.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.87.3e-1641102162
                  XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                  +ke kr +r+ +NR++A+  R+RKka++ eLe +vkeLe++N++L +++++l++e + l++ 
  Aco014284.1  41 DKEHKRLKRLLRNRVSAQQARERKKAYLNELEARVKELETKNSELEERVSTLQNENQMLRQI 102
                  5899*****************************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000418.3E-54056IPR001630cAMP response element binding (CREB) protein
SMARTSM003381.4E-1641105IPR004827Basic-leucine zipper domain
PfamPF001701.3E-1442103IPR004827Basic-leucine zipper domain
PROSITE profilePS5021713.05943106IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.13E-1445103No hitNo description
Gene3DG3DSA:1.20.5.1703.1E-1845105No hitNo description
CDDcd147042.63E-144697No hitNo description
PROSITE patternPS0003604863IPR004827Basic-leucine zipper domain
PRINTSPR000418.3E-55878IPR001630cAMP response element binding (CREB) protein
PRINTSPR000418.3E-57895IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MYTNEIRSRY ELTSIEQREI VELGSSDGSQ RRQRSGRSSA DKEHKRLKRL LRNRVSAQQA  60
RERKKAYLNE LEARVKELET KNSELEERVS TLQNENQMLR QILKNTTVSR RGSSSSANVG  120
EGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_B2e-1566105342Transcription factor HY5
2oqq_A2e-1566105342Transcription factor HY5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010914895.19e-49PREDICTED: transcription factor HY5
SwissprotQ9SM508e-40HY5_SOLLC; Transcription factor HY5
TrEMBLM0RLS92e-47M0RLS9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P27050_0016e-47(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.16e-36bZIP family protein