PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco013815.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family GRAS
Protein Properties Length: 456aa    MW: 52036.1 Da    PI: 5.1772
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco013815.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS404.41.2e-123634381373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn......sseelaalklfsevsPilk 92 
                  lv+lL++cAe +ss ++e+++ +Larl e+asp+g+++qR+aayfteA a r +r  ++++++ pp+e + +        ++ ++al+lf+ vsPi+k
  Aco013815.1  63 LVSLLVSCAESISSLNHEAVDYFLARLGERASPRGTTVQRVAAYFTEAFAFRAVRLFPHMFSIAPPRELTYHIeeysddDDDGATALRLFNYVSPIPK 160
                  689***************************************************************999854366666677888999*********** PP

         GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                  f h+t N+ +l+a++g+ervH+iDfdi+ GlQWp+Llq+LasRp++p ++RiTg+g+     +e+l+  g rLa+fAe+l++pf+f++ v++rl+d++
  Aco013815.1 161 FLHFTLNERLLQAFDGKERVHVIDFDIKDGLQWPSLLQSLASRPNPPSHVRITGIGK----YRENLQDAGVRLARFAEALNLPFKFHA-VVERLDDVR 253
                  *********************************************************....9**************************.7******** PP

         GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                  l++L+vk++E++aVn+vl +h+ll ++vs +   +++L+l++s++P +v + eqe + n++++  rf ++l+yysa+fdsl++ lp++s  rikvE++
  Aco013815.1 254 LWMLHVKRDECIAVNCVLVMHKLL-SDVSGSA-LRRFLELIRSTNPSIVLLGEQEDENNEQRWEVRFGKSLQYYSAIFDSLDSLLPENSALRIKVEEM 349
                  ************************.4444444.79*************************************************************** PP

         GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee.....sgslvlgWkdrpLvsvSaW 373
                   ++rei+ +va eg+er+erhe++++Wre +e+ GF+++ ++e++++q ++++r+++s+ ++ve +        l+l W d+pL++vSaW
  Aco013815.1 350 -FAREIRTIVAWEGSERVERHESFRRWREIMENGGFRNLDIGEREMAQSQTIVRMYSSENFTVERQgegegYRGLTLKWLDQPLYTVSAW 438
                  .********************************************************999****554444478999************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.2737414IPR005202Transcription factor GRAS
PfamPF035144.0E-12163438IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MQIAKTPINS GIEVSIAQKL ARLEEIFLVP GASCFPLSVN FFKPDEGFDR YEGLILEQPD  60
AELVSLLVSC AESISSLNHE AVDYFLARLG ERASPRGTTV QRVAAYFTEA FAFRAVRLFP  120
HMFSIAPPRE LTYHIEEYSD DDDDGATALR LFNYVSPIPK FLHFTLNERL LQAFDGKERV  180
HVIDFDIKDG LQWPSLLQSL ASRPNPPSHV RITGIGKYRE NLQDAGVRLA RFAEALNLPF  240
KFHAVVERLD DVRLWMLHVK RDECIAVNCV LVMHKLLSDV SGSALRRFLE LIRSTNPSIV  300
LLGEQEDENN EQRWEVRFGK SLQYYSAIFD SLDSLLPENS ALRIKVEEMF AREIRTIVAW  360
EGSERVERHE SFRRWREIME NGGFRNLDIG EREMAQSQTI VRMYSSENFT VERQGEGEGY  420
RGLTLKWLDQ PLYTVSAWAP NEPAHVGYSS LSLPT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A5e-687044025379Protein SCARECROW
5b3h_D5e-687044025379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020114729.10.0scarecrow-like protein 28
SwissprotQ9CAN31e-145SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A199UF540.0A0A199UF54_ANACO; Scarecrow-like protein 28
STRINGXP_008800814.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-147GRAS family protein