PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco013736.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family M-type_MADS
Protein Properties Length: 351aa    MW: 39543.4 Da    PI: 5.8089
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco013736.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.92.4e-221053245
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                 + en+s rqvt+skRr+gilKKA+ELS+LCd++  +++fs+tgk
  Aco013736.1 10 KLENSSGRQVTYSKRRAGILKKAKELSILCDIDLVLLMFSPTGK 53
                 679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.698153IPR002100Transcription factor, MADS-box
SMARTSM004326.5E-30160IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.41E-26295IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGRVKLKIKK LENSSGRQVT YSKRRAGILK KAKELSILCD IDLVLLMFSP TGKPTLCVGD  60
RSNIEEVISK YAQLTPQERA KRKLESLEAL KKTFKKLDHD VNIQEFLGCS SQTVEELTSH  120
LQSLQAQLSD VEKRLSYWSD PEKVDNIDHI RAMEQSLNES LGRIRVHKEN VGKQIMSLQC  180
TGQFQNDMHL PMGFSVDHGP SPVSWIHNGD VQQMMLPEDP SLLSQRDIGC STDTSLQSYP  240
GYYMTGKQTE SNEQIPADNS LHDFSQNACL RLNLGGHFPY QSYDPNLFTD KPFKPDEENN  300
NLCNSGIDCQ VNHYDPPRPA YDASFQSWAS TSGTCDIGLF DEQSYTQQPN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-12192190MEF2 CHIMERA
6byy_B1e-12192190MEF2 CHIMERA
6byy_C1e-12192190MEF2 CHIMERA
6byy_D1e-12192190MEF2 CHIMERA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6617831e-136KM661783.1 Ananas bracteatus clone 44678b microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020101467.10.0agamous-like MADS-box protein AGL30 isoform X1
TrEMBLA0A3Q0I6670.0A0A3Q0I667_PHODC; agamous-like MADS-box protein AGL65 isoform X3
STRINGXP_008797164.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.26e-91AGAMOUS-like 30