PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco013561.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family LBD
Protein Properties Length: 227aa    MW: 24183.5 Da    PI: 8.3242
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco013561.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260101.67.3e-32271261100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +C aC+ lrr+C ++Cv+ap+fp +qp++fa+v++++G+ nv++ll++lp+e+r++a++sl+yeA +++rd v Ga+gv++ ++++l++l+ el  ++
  Aco013561.1  27 PCTACRQLRRGCRPGCVFAPCFPPSQPNRFAIVRRVYGVGNVQRLLEELPPERRPAATDSLAYEASMQLRDRVFGAAGVVSLYEHRLHSLQLELLCAR 124
                  7******************************************************************************************9998877 PP

       DUF260  99 ee 100
                  +e
  Aco013561.1 125 AE 126
                  65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.52526127IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3027122IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MANEAAANSA LAGGVAAAAG RPAIVHPCTA CRQLRRGCRP GCVFAPCFPP SQPNRFAIVR  60
RVYGVGNVQR LLEELPPERR PAATDSLAYE ASMQLRDRVF GAAGVVSLYE HRLHSLQLEL  120
LCARAELSTY ECSNRNDANR VPQITNQKFS KVCGGRGGGW GDGWYEAMRV EGCVSEAKIA  180
ERLAAATDAA VVSIRPVEDR IAATMTATAV AKSSNQIEDA ANNQII*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-33171321116LOB family transfactor Ramosa2.1
5ly0_B1e-33171321116LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020111049.11e-165LOB domain-containing protein 6-like
TrEMBLA0A199VJA91e-123A0A199VJA9_ANACO; LOB domain-containing protein 6
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.42e-28LBD family protein